JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB79564

Recombinant Human CCN3 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CCN3 protein is a Human Fragment protein, in the 260 to 357 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

IGFBP9, NOV, NOVH, CCN3, CCN family member 3, Cellular communication network factor 3, Insulin-like growth factor-binding protein 9, Nephro blastoma-overexpressed gene protein homolog, Protein NOV homolog, IBP-9, IGF-binding protein 9, IGFBP-9, NovH

1 Images
SDS-PAGE - Recombinant Human CCN3 protein (AB79564)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CCN3 protein (AB79564)

ab79564 on 15% SDS PAGE gel, Coomassie blue staining.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

WB, SDS-PAGE, ELISA

applications

Biologically active

No

Accession

P48745

Animal free

No

Carrier free

Yes

Species

Human

Storage buffer

Constituents: 2.68% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":357,"aminoAcidStart":260,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P48745","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CCN3 also known as NOV (Nephroblastoma Overexpressed) is a protein that has important roles in cellular processes. This protein belongs to the CCN family of proteins with an approximate molecular mass of 34-38 kDa. CCN3 is expressed in various tissues including kidney heart and brain reflecting its involvement in diverse physiological activities. It is particularly noted for its role in tissue development and repair processes.
Biological function summary

CCN3 influences several aspects of cell behavior including proliferation differentiation and migration. It does not function as part of a larger complex but acts as an individual entity facilitating communication between cells and the extracellular matrix. CCN3 also affects angiogenesis a critical process in both health and disease by modulating vascular endothelial growth factor (VEGF) pathways therefore impacting blood vessel formation and maintenance.

Pathways

CCN3 interacts primarily with key signaling pathways such as Wnt and TGF-beta signaling. Within the Wnt pathway CCN3 serves as a regulatory component modulating the activity of other proteins involved in cell growth. Similarly in the TGF-beta pathway it contributes to the regulation of cellular proliferation and differentiation by affecting interactions with other proteins like SMADs which are signal transducers in TGF-beta signaling.

CCN3 has connections to conditions like nephroblastoma often referred to as Wilms Tumor and fibrosis. In nephroblastoma altered expression of CCN3 correlates with tumor progression and metastasis. It interacts with proteins like WNT1 influencing tumor growth and development. In fibrosis which affects organs such as the liver and lungs CCN3’s modulation of TGF-beta signaling plays a significant role impacting fibrogenesis through its interaction with ECM components.

Specifications

Form

Liquid

General info

Function

Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival (PubMed : 12050162, PubMed : 12695522, PubMed : 15181016, PubMed : 15611078, PubMed : 21344378). Acts by binding to integrins or membrane receptors such as NOTCH1 (PubMed : 12695522, PubMed : 15611078, PubMed : 21344378). Essential regulator of hematopoietic stem and progenitor cell function (PubMed : 17463287). Inhibits myogenic differentiation through the activation of Notch-signaling pathway (PubMed : 12050162). Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling (PubMed : 20139355). Ligand of integrins ITGAV : ITGB3 and ITGA5 : ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival (PubMed : 12695522). Also plays a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5 : ITGB1 and ITGA6 : ITGB1 and induces fibroblast chemotaxis through ITGAV : ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts (PubMed : 15611078). Involved in bone regeneration as a negative regulator (By similarity). Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification (PubMed : 21871891). Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion (By similarity). Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway (PubMed : 21063504). Contributes to the control and coordination of inflammatory processes in atherosclerosis (By similarity). Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement (PubMed : 21871891). Brain osteoanabolic hormone (By similarity). Drives osteogenesis in osteochondral skeletal stem cells (PubMed : 38987585). During lactation, maintains the maternal skeleton and viability of offspring (By similarity).

Sequence similarities

Belongs to the CCN family.

Post-translational modifications

May be palmitoylated on Cys-244, which is important for extracellular secretion.

Product protocols

Target data

Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival (PubMed : 12050162, PubMed : 12695522, PubMed : 15181016, PubMed : 15611078, PubMed : 21344378). Acts by binding to integrins or membrane receptors such as NOTCH1 (PubMed : 12695522, PubMed : 15611078, PubMed : 21344378). Essential regulator of hematopoietic stem and progenitor cell function (PubMed : 17463287). Inhibits myogenic differentiation through the activation of Notch-signaling pathway (PubMed : 12050162). Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling (PubMed : 20139355). Ligand of integrins ITGAV : ITGB3 and ITGA5 : ITGB1, acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells, supports cell adhesion, induces directed cell migration (chemotaxis) and promotes cell survival (PubMed : 12695522). Also plays a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5 : ITGB1 and ITGA6 : ITGB1 and induces fibroblast chemotaxis through ITGAV : ITGB5. Seems to enhance bFGF-induced DNA synthesis in fibroblasts (PubMed : 15611078). Involved in bone regeneration as a negative regulator (By similarity). Enhances the articular chondrocytic phenotype, whereas it repressed the one representing endochondral ossification (PubMed : 21871891). Impairs pancreatic beta-cell function, inhibits beta-cell proliferation and insulin secretion (By similarity). Plays a role as negative regulator of endothelial pro-inflammatory activation reducing monocyte adhesion, its anti-inflammatory effects occur secondary to the inhibition of NF-kappaB signaling pathway (PubMed : 21063504). Contributes to the control and coordination of inflammatory processes in atherosclerosis (By similarity). Attenuates inflammatory pain through regulation of IL1B- and TNF-induced MMP9, MMP2 and CCL2 expression. Inhibits MMP9 expression through ITGB1 engagement (PubMed : 21871891). Brain osteoanabolic hormone (By similarity). Drives osteogenesis in osteochondral skeletal stem cells (PubMed : 38987585). During lactation, maintains the maternal skeleton and viability of offspring (By similarity).
See full target information CCN3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com