JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114168

Recombinant Human CCR2 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CCR2 protein is a Human Fragment protein, in the 1 to 42 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD192, CMKBR2, CCR2, C-C chemokine receptor type 2, C-C CKR-2, CC-CKR-2, CCR-2, Monocyte chemoattractant protein 1 receptor, MCP-1-R

1 Images
SDS-PAGE - Recombinant Human CCR2 protein (AB114168)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CCR2 protein (AB114168)

ab114168 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P41597

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA","proteinLength":"Fragment","predictedMolecularWeight":"30.25 kDa","actualMolecularWeight":null,"aminoAcidEnd":42,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P41597","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CCR2 also known as C-C chemokine receptor type 2 is a protein involved in immune cell trafficking. It is a member of the G-protein-coupled receptor family and has a molecular mass of approximately 43 kDa. CCR2 is primarily expressed on monocytes dendritic cells and certain subsets of T cells. It functions as a receptor for monocyte chemoattractant proteins (MCPs) with MCP-1 (CCL2) being the most well-known ligand. The interaction between CCR2 and its ligands directs the movement of these immune cells to sites of inflammation or tissue injury.
Biological function summary

CCR2 plays an important role in mediating leukocyte migration. It acts in the immune system to guide monocytes from the bloodstream into tissues contributing to immune surveillance and response. CCR2 operates not as part of a larger receptor complex but it does interact closely with other chemokine receptors which may influence its signaling. The receptor's activity has critical implications for inflammatory processes and lies at the heart of many immune responses.

Pathways

CCR2 is integrally involved in the chemokine signaling pathway and the inflammatory response pathway. Its function in these pathways highlights its role in modulating immune cell infiltration during immune challenges. The receptor also interfaces with other important signaling proteins such as CCR5 which like CCR2 is another chemokine receptor involved in mediating immune cell movement. These interactions overlap and complement each other offering nuanced regulation of immune cell dynamics.

CCR2 has connections to conditions such as atherosclerosis and rheumatoid arthritis. In atherosclerosis the receptor's involvement in monocyte recruitment to the arterial wall is an important step in plaque formation. Its role in rheumatoid arthritis centers on the promotion of leukocyte infiltration into the joint tissues contributing to inflammation and joint damage. CCR2's connection to such disorders often aligns with a similar role played by other chemokine receptors like CCR5 highlighting its relevance in inflammation-related pathologies.

Specifications

Form

Liquid

General info

Function

Key functional receptor for CCL2 but can also bind CCL7, and CCL12 (PubMed : 23408426, PubMed : 38157855, PubMed : 8048929, PubMed : 8146186). Also transduces signaling mediated by CCL13 (PubMed : 38157855). Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (PubMed : 38157855). Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B (PubMed : 23938203). Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation (By similarity). Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R (By similarity). Plays an important role in mediating peripheral nerve injury-induced neuropathic pain (By similarity). Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B (By similarity). Mediates the recruitment of macrophages and monocytes to the injury site following brain injury (By similarity).. (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

N-glycosylated.. Sulfation increases the affinity for both monomeric and dimeric CCL2 with stronger binding to the monomeric form (PubMed:11046064, PubMed:23408426). Binding of sulfated CCR2 to CCL2 promotes conversion of CCL2 from dimer to monomer (PubMed:11046064, PubMed:23408426).

Product protocols

Target data

Key functional receptor for CCL2 but can also bind CCL7, and CCL12 (PubMed : 23408426, PubMed : 38157855, PubMed : 8048929, PubMed : 8146186). Also transduces signaling mediated by CCL13 (PubMed : 38157855). Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (PubMed : 38157855). Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B (PubMed : 23938203). Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation (By similarity). Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R (By similarity). Plays an important role in mediating peripheral nerve injury-induced neuropathic pain (By similarity). Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B (By similarity). Mediates the recruitment of macrophages and monocytes to the injury site following brain injury (By similarity).. (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
See full target information CCR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com