JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158144

Recombinant Human CCR5 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CCR5 protein is a Human Full Length protein, in the 1 to 352 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

CD195, CMKBR5, CCR5, C-C chemokine receptor type 5, C-C CKR-5, CC-CKR-5, CCR-5, CHEMR13, HIV-1 fusion coreceptor

1 Images
SDS-PAGE - Recombinant Human CCR5 protein (AB158144)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CCR5 protein (AB158144)

ab158144 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

P51681

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":352,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P51681","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CCR5 also known as the C-C chemokine receptor type 5 is a protein that functions as a receptor on the surface of cells predominantly immune cells like T-cells macrophages and dendritic cells. The approximate molecular weight of CCR5 is 40 kDa. This protein belongs to the G-protein-coupled receptor family and it mainly binds to β-chemokines. CCR5 is abundantly expressed in immune tissues such as the spleen thymus and lymph nodes. Researchers often use assays like the CCR5 ELISA kit to detect or quantify its presence in various samples.
Biological function summary

CCR5 acts as a receptor for various chemokines specifically CCL3 CCL4 and CCL5 which are involved in leukocyte trafficking and immune response modulation. It plays an important role in the migration of immune cells to sites of inflammation or injury. This protein does not function in isolation; it sometimes forms part of larger complexes with other cell surface proteins to mediate responses to external signals. For example anti-CCR5 antibodies like 12D1 can modulate its activity and influence immune cell behavior.

Pathways

CCR5 is intricately involved in chemokine signaling pathways and inflammatory response pathways. Through these pathways it interacts with proteins such as CXCR4 and CCR1. CCR5 and CXCR4 another chemokine receptor are well-documented for their role in HIV entry into host cells. These pathways are critical for orchestrating immune cell movement and activating signaling cascades that promote immune defense mechanisms.

CCR5 has a significant association with HIV infection and is a known co-receptor facilitating the virus's entry into immune cells. The presence of mutations like the Δ32 allele in the CCR5 gene provides resistance against HIV infection highlighting its importance in disease dynamics. CCR5 also plays a role in inflammatory diseases such as rheumatoid arthritis where it contributes to the migration of immune cells into joints exacerbating inflammation. In these contexts CCR5 interacts with other inflammatory mediators offering potential therapeutic targets for drug development.

Specifications

Form

Liquid

General info

Function

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor (PubMed : 30713770).. (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) of human immunodeficiency virus-1/HIV-1.

Sequence similarities

Belongs to the G-protein coupled receptor 1 family.

Post-translational modifications

Sulfated on at least 2 of the N-terminal tyrosines. Sulfation contributes to the efficiency of HIV-1 entry and is required for efficient binding of the chemokines, CCL3 and CCL4.. O-glycosylated, but not N-glycosylated. Ser-6 appears to be the major site even if Ser-7 may be also O-glycosylated. Also sialylated glycans present which contribute to chemokine binding. Thr-16 and Ser-17 may also be glycosylated and, if so, with small moieties such as a T-antigen.. Palmitoylation in the C-terminal is important for cell surface expression, and to a lesser extent, for HIV entry.. Phosphorylation on serine residues in the C-terminal is stimulated by binding CC chemokines especially by APO-RANTES.

Product protocols

Target data

Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor (PubMed : 30713770).. (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) of human immunodeficiency virus-1/HIV-1.
See full target information CCR5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com