JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB114303

Recombinant Human CD130 (gp130) protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD130 (gp130) protein is a Human Fragment protein, in the 23 to 122 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD130, Interleukin-6 receptor subunit beta, IL-6 receptor subunit beta, IL-6R subunit beta, IL-6R-beta, IL-6RB, CDw130, Interleukin-6 signal transducer, Membrane glycoprotein 130, Oncostatin-M receptor subunit alpha, gp130, IL6ST

1 Images
SDS-PAGE - Recombinant Human CD130 (gp130) protein (AB114303)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD130 (gp130) protein (AB114303)

12.5% SDS-PAGE image showing ab114303 at approx 36.63 kDa. Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB, SDS-PAGE

applications

Biologically active

No

Accession

P40189

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS","proteinLength":"Fragment","predictedMolecularWeight":"36.63 kDa","actualMolecularWeight":null,"aminoAcidEnd":122,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P40189","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD130 also known as gp130 or the IL-6 signal transducer (IL6ST) is a protein weighing around 130 kDa. This receptor is encoded by the IL6ST gene and widely expressed on the surface of cells across multiple tissues. CD130 functions mechanically as a signal transducing receptor facilitating the assembly of receptor complexes necessary for the initiation of signal transduction. It plays a major role in cytokine receptor signaling particularly interacting with interleukin-6 (IL-6) family cytokines.
Biological function summary

CD130 functions as part of the high-affinity receptor complex for certain cytokines. It partners with other receptors such as CD126 to form a complex that initiates signaling pathways after ligand binding contributing to a range of immune responses. Its role is thorough across many cellular processes including differentiation proliferation and apoptosis. In addition to immune signaling CD130 is involved in several growth factor signaling pathways.

Pathways

CD130 serves a significant role in signal transduction particularly in the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway. It works in concert with related proteins like JAK1 and STAT3 to transmit signals from extracellular cytokines to the nucleus influencing gene expression. Additionally CD130 can also be found active in the MAPK/ERK pathway which is important for cellular response to growth signals.

CD130 plays a connection especially to inflammatory conditions and certain cancers. Aberrant signaling involving CD130 has been linked to disorders like rheumatoid arthritis where it contributes to the inflammation process. Additionally it relates to multiple myeloma a cancer where abnormal CD130 interactions with proteins like IL-6 may enhance cell survival and proliferation presenting potential targets for therapeutic intervention.

Specifications

Form

Liquid

General info

Function

Signal-transducing molecule (PubMed : 2261637). The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize IL6ST for initiating signal transmission. Binding of IL6 to IL6R induces IL6ST homodimerization and formation of a high-affinity receptor complex, which activates the intracellular JAK-MAPK and JAK-STAT3 signaling pathways (PubMed : 19915009, PubMed : 2261637, PubMed : 23294003). That causes phosphorylation of IL6ST tyrosine residues which in turn activates STAT3 (PubMed : 19915009, PubMed : 23294003, PubMed : 25731159). In parallel, the IL6 signaling pathway induces the expression of two cytokine receptor signaling inhibitors, SOCS1 and SOCS3, which inhibit JAK and terminate the activity of the IL6 signaling pathway as a negative feedback loop (By similarity). Also activates the yes-associated protein 1 (YAP) and NOTCH pathways to control inflammation-induced epithelial regeneration, independently of STAT3 (By similarity). Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL27RA/WSX1 and CNTFR (PubMed : 19386761). Mediates signals which regulate immune response, hematopoiesis, pain control and bone metabolism (By similarity). Has a role in embryonic development (By similarity). Essential for survival of motor and sensory neurons and for differentiation of astrocytes (By similarity). Required for expression of TRPA1 in nociceptive neurons (By similarity). Required for the maintenance of PTH1R expression in the osteoblast lineage and for the stimulation of PTH-induced osteoblast differentiation (By similarity). Required for normal trabecular bone mass and cortical bone composition (By similarity).. Isoform 2. Binds to the soluble IL6 : sIL6R complex (hyper-IL6), thereby blocking IL6 trans-signaling. Inhibits sIL6R-dependent acute phase response (PubMed : 11121117, PubMed : 21990364, PubMed : 30279168). Also blocks IL11 cluster signaling through IL11R (PubMed : 30279168).

Sequence similarities

Belongs to the type I cytokine receptor family. Type 2 subfamily.

Post-translational modifications

Phosphorylation of Ser-782 down-regulates cell surface expression.. Heavily N-glycosylated (PubMed:11098061, PubMed:11251120, PubMed:16335952, PubMed:19139490, PubMed:19159218). Glycosylation is required for protein stability and localization in plasma membrane but not for ligand binding (PubMed:19915009).

Product protocols

Target data

Signal-transducing molecule (PubMed : 2261637). The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize IL6ST for initiating signal transmission. Binding of IL6 to IL6R induces IL6ST homodimerization and formation of a high-affinity receptor complex, which activates the intracellular JAK-MAPK and JAK-STAT3 signaling pathways (PubMed : 19915009, PubMed : 2261637, PubMed : 23294003). That causes phosphorylation of IL6ST tyrosine residues which in turn activates STAT3 (PubMed : 19915009, PubMed : 23294003, PubMed : 25731159). In parallel, the IL6 signaling pathway induces the expression of two cytokine receptor signaling inhibitors, SOCS1 and SOCS3, which inhibit JAK and terminate the activity of the IL6 signaling pathway as a negative feedback loop (By similarity). Also activates the yes-associated protein 1 (YAP) and NOTCH pathways to control inflammation-induced epithelial regeneration, independently of STAT3 (By similarity). Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL27RA/WSX1 and CNTFR (PubMed : 19386761). Mediates signals which regulate immune response, hematopoiesis, pain control and bone metabolism (By similarity). Has a role in embryonic development (By similarity). Essential for survival of motor and sensory neurons and for differentiation of astrocytes (By similarity). Required for expression of TRPA1 in nociceptive neurons (By similarity). Required for the maintenance of PTH1R expression in the osteoblast lineage and for the stimulation of PTH-induced osteoblast differentiation (By similarity). Required for normal trabecular bone mass and cortical bone composition (By similarity).. Isoform 2. Binds to the soluble IL6 : sIL6R complex (hyper-IL6), thereby blocking IL6 trans-signaling. Inhibits sIL6R-dependent acute phase response (PubMed : 11121117, PubMed : 21990364, PubMed : 30279168). Also blocks IL11 cluster signaling through IL11R (PubMed : 30279168).
See full target information IL6ST

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com