JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB290112

Recombinant Human CD14 Protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD14 Protein (Active) is a Human Full Length protein, in the 20 to 352 aa range, expressed in HEK 293 cells, with >95%, <0.005 EU/µg endotoxin level, suitable for HPLC, Mass Spec, SDS-PAGE, FuncS.

View Alternative Names

CD14, Monocyte differentiation antigen CD14, My23 antigen, Myeloid cell-specific leucine-rich glycoprotein

4 Images
Biological Activity - Recombinant Human CD14 Protein (Active) (AB290112)
  • Biological Activity

Lab

Biological Activity - Recombinant Human CD14 Protein (Active) (AB290112)

Fully biologically active determined by its ability to enhance LPS-induced IL-8 secretion in THP-1 human acute monocytic leukemia cells. ED50 is ≤ 49.2 ng/ml, corresponding to a specific activity of 2.03 x 10^4 units/mg.

Mass Spectrometry - Recombinant Human CD14 Protein (Active) (AB290112)
  • Mass Spec

Supplier Data

Mass Spectrometry - Recombinant Human CD14 Protein (Active) (AB290112)

Mass determination by ESI-TOF. Predicted MW is 35830.06 Da (+/-10 Da by ESI-TOF). Observed MW is 35834.28 Da.

SDS-PAGE - Recombinant Human CD14 Protein (Active) (AB290112)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD14 Protein (Active) (AB290112)

SDS-PAGE analysis of ab290112

HPLC - Recombinant Human CD14 Protein (Active) (AB290112)
  • HPLC

Supplier Data

HPLC - Recombinant Human CD14 Protein (Active) (AB290112)

HPLC analysis of ab290112

Key facts

Purity

>95% HPLC

Endotoxin level

<0.005 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

FuncS, HPLC, SDS-PAGE, Mass Spec

applications

Biologically active

Yes

Biological activity

Fully biologically active determined by its ability to enhance LPS-induced IL-8 secretion in THP-1 human acute monocytic leukemia cells.

ED50 is ≤ 49.2 ng/ml, corresponding to a specific activity of 2.03 x 104 units/mg.

Accession

P08571

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 10.26% Trehalose, 0.727% Dibasic monohydrogen potassium phosphate, 0.248% Potassium phosphate monobasic

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC","proteinLength":"Full Length","predictedMolecularWeight":"35.83 kDa","actualMolecularWeight":"35.83 kDa","aminoAcidEnd":352,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08571","tags":[]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
Ambient
Appropriate long-term storage conditions
Ambient
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD14 also known as cluster of differentiation 14 is a glycoprotein with a molecular mass of approximately 55 kDa. This protein is expressed mainly on the surface of macrophages monocytes and to a lesser extent on neutrophils. CD14 exists in two forms: membrane-bound (mCD14) and soluble (sCD14). It functions as a co-receptor along with TLR4 (Toll-like receptor 4) and MD-2 for the detection of bacterial lipopolysaccharide (LPS) which is an important component of the outer membrane of Gram-negative bacteria.
Biological function summary

This glycoprotein plays a significant role in the innate immune system by recognizing pathogen-associated molecular patterns (PAMPs). It is part of a receptor complex where CD14 acts alongside LPS binding protein (LPS-R) TLR4 and MD-2 to facilitate pro-inflammatory signaling in response to microbial invasion. By binding to LPS CD14 initiates and amplifies the immune response leading to the production of cytokines and the recruitment of other immune cells to the site of infection.

Pathways

CD14 interacts with the toll-like receptor signaling pathway notably involving TLR4. Upon LPS detection CD14 assists in the activation of TLR4 triggering downstream signaling cascades such as NF-κB and MAPK pathways. These pathways result in the transcription of inflammatory cytokines and are essential for the host defense mechanism. The protein complex involving CD14 further interacts with adaptor proteins like MyD88 and TRIF facilitating signal propagation and the immune system's ability to respond to pathogens.

Researchers have linked CD14 to sepsis and atherosclerosis. High levels of soluble CD14 (sCD14) are often observed in patients with sepsis indicating its participation in excessive systemic inflammation. In atherosclerosis CD14's role in recognizing LPS contributes to chronic inflammation and the development of plaques in arteries. Through these diseases CD14 connects with TLR4 emphasizing its impact on inflammatory responses and its potential as a therapeutic target.

Specifications

Form

Lyophilized

Additional notes

SDS-PAGE >= 95%

General info

Function

Coreceptor for bacterial lipopolysaccharide (PubMed : 1698311, PubMed : 23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 20133493, PubMed : 22265692, PubMed : 23264655). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 8612135). Acts as a coreceptor for TLR2 : TLR6 heterodimer in response to diacylated lipopeptides and for TLR2 : TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (PubMed : 16880211). Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (PubMed : 23880187).

Post-translational modifications

N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.

Product protocols

Target data

Coreceptor for bacterial lipopolysaccharide (PubMed : 1698311, PubMed : 23264655). In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS) (PubMed : 20133493, PubMed : 22265692, PubMed : 23264655). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (PubMed : 8612135). Acts as a coreceptor for TLR2 : TLR6 heterodimer in response to diacylated lipopeptides and for TLR2 : TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway (PubMed : 16880211). Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-) (PubMed : 23880187).
See full target information CD14

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com