JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271508

Recombinant Human CD16 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD16 protein (His tag) is a Human Fragment protein, in the 17 to 208 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD16a, CD16A, FCG3, FCGR3, IGFR3, FCGR3A, Low affinity immunoglobulin gamma Fc region receptor III-A, IgG Fc receptor III-A, CD16-II, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, Fc-gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcgammaRIIIA

1 Images
SDS-PAGE - Recombinant Human CD16 protein (His tag) (AB271508)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD16 protein (His tag) (AB271508)

SDS-PAGE analysis of 3 μg ab271508.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Avi tag N-Terminus His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P08637

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ","proteinLength":"Fragment","predictedMolecularWeight":"25 kDa","actualMolecularWeight":null,"aminoAcidEnd":208,"aminoAcidStart":17,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08637","tags":[{"tag":"Avi","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD16 also known as FCGR3A or CD16A protein is a low-affinity receptor for the Fc region of IgG. It weighs approximately 50-70 kDa and exists on the surface of several immune cells such as natural killer (NK) cells some populations of T cells and macrophages. The expression of CD16 mediates various cellular responses including antibody-dependent cellular cytotoxicity (ADCC) where it acts by engaging with immune complexes. Researchers often use anti-CD16 antibodies in flow cytometry to analyze the presence and quantity of CD16-expressing cells.
Biological function summary

This receptor plays a significant role in immune system regulation by contributing to the activation of immune effector cells. CD16 is not part of a larger complex but it operates in concert with CD3 proteins to trigger intracellular signaling pathways upon engagement with its ligand. Its function is important for the antibody-dependent clearance of infected or malignant cells from the body representing an essential linkage between innate and adaptive immunity.

Pathways

Signaling involving CD16 is integrated into the immune response mechanisms that include the Fc gamma receptor-mediated phagocytosis pathway. This pathway involves interactions with IgG antibodies and complements the activity of other Fc gamma receptors such as CD32 and CD64. Through these interactions CD16 enhances phagocytic activity and stimulates the secretion of cytokines and chemokines important for orchestrating an effective immune response.

CD16 plays an important role in conditions like autoimmune diseases and certain cancers. Its expression and function are important in the pathophysiology of systemic lupus erythematosus where an imbalance in immune complex clearance leads to tissue damage. In oncology CD16 aids in the immune system's recognition and elimination of tumor cells working alongside proteins such as CD3 in modulating the body's anti-tumor response. Understanding CD16's involvement in these diseases helps in developing therapeutic strategies that harness the immune system's power such as monoclonal antibody therapies targeting CD16.

Specifications

Form

Liquid

General info

Function

Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (PubMed : 11711607, PubMed : 21768335, PubMed : 22023369, PubMed : 24412922, PubMed : 25786175, PubMed : 25816339, PubMed : 28652325, PubMed : 8609432, PubMed : 9242542). Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation. Involved in the generation of memory-like adaptive NK cells capable to produce high amounts of IFNG and to efficiently eliminate virus-infected cells via ADCC (PubMed : 24412922, PubMed : 25786175). Regulates NK cell survival and proliferation, in particular by preventing NK cell progenitor apoptosis (PubMed : 29967280, PubMed : 9916693). Fc-binding subunit that associates with CD247 and/or FCER1G adapters to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapters with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation. The ITAM-dependent signaling coupled to receptor phosphorylation by PKC mediates robust intracellular calcium flux that leads to production of pro-inflammatory cytokines, whereas in the absence of receptor phosphorylation it mainly activates phosphatidylinositol 3-kinase signaling leading to cell degranulation (PubMed : 1825220, PubMed : 23024279, PubMed : 2532305). Costimulates NK cells and trigger lysis of target cells independently of IgG binding (PubMed : 10318937, PubMed : 23006327). Mediates the antitumor activities of therapeutic antibodies. Upon ligation on monocytes triggers TNFA-dependent ADCC of IgG-coated tumor cells (PubMed : 27670158). Mediates enhanced ADCC in response to afucosylated IgGs (PubMed : 34485821).. (Microbial infection) Involved in Dengue virus pathogenesis via antibody-dependent enhancement (ADE) mechanism. Secondary infection with Dengue virus triggers elevated levels of afucosylated non-neutralizing IgG1s with reactivity to viral envelope/E protein. Viral antigen-IgG1 complexes bind with high affinity to FCGR3A, facilitating virus entry in myeloid cells and subsequent viral replication.

Post-translational modifications

Glycosylated. Contains high mannose- and complex-type oligosaccharides. Glycosylation at Asn-180 is mandatory for high affinity binding to the Fc and for discrimination between fucosylated and afucosylated IgG glycoforms.. Undergoes rapid ectodomain shedding upon NK cell stimulation. The soluble form is produced by a proteolytic cleavage mediated by ADAM17. Repeated stimulation causes receptor shedding, a mechanism that allows for increased NK cell motility and detachment from opsonized target cells while avoiding activation-induced NK cell apoptosis.. Phosphorylated at RSSTR motif by PKC. The relevant physiological PKCs might be PRKCI, PRKCG, PRKCE, PRKCH and PRKCQ.

Product protocols

Target data

Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (PubMed : 11711607, PubMed : 21768335, PubMed : 22023369, PubMed : 24412922, PubMed : 25786175, PubMed : 25816339, PubMed : 28652325, PubMed : 8609432, PubMed : 9242542). Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation. Involved in the generation of memory-like adaptive NK cells capable to produce high amounts of IFNG and to efficiently eliminate virus-infected cells via ADCC (PubMed : 24412922, PubMed : 25786175). Regulates NK cell survival and proliferation, in particular by preventing NK cell progenitor apoptosis (PubMed : 29967280, PubMed : 9916693). Fc-binding subunit that associates with CD247 and/or FCER1G adapters to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapters with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation. The ITAM-dependent signaling coupled to receptor phosphorylation by PKC mediates robust intracellular calcium flux that leads to production of pro-inflammatory cytokines, whereas in the absence of receptor phosphorylation it mainly activates phosphatidylinositol 3-kinase signaling leading to cell degranulation (PubMed : 1825220, PubMed : 23024279, PubMed : 2532305). Costimulates NK cells and trigger lysis of target cells independently of IgG binding (PubMed : 10318937, PubMed : 23006327). Mediates the antitumor activities of therapeutic antibodies. Upon ligation on monocytes triggers TNFA-dependent ADCC of IgG-coated tumor cells (PubMed : 27670158). Mediates enhanced ADCC in response to afucosylated IgGs (PubMed : 34485821).. (Microbial infection) Involved in Dengue virus pathogenesis via antibody-dependent enhancement (ADE) mechanism. Secondary infection with Dengue virus triggers elevated levels of afucosylated non-neutralizing IgG1s with reactivity to viral envelope/E protein. Viral antigen-IgG1 complexes bind with high affinity to FCGR3A, facilitating virus entry in myeloid cells and subsequent viral replication.
See full target information FCGR3A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com