JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB198433

Recombinant Human CD160 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD160 protein (His tag) is a Human Fragment protein, in the 27 to 159 aa range, expressed in HEK 293 cells, with >90%, < 0.1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD160, BY55, CD160 antigen, Natural killer cell receptor BY55

1 Images
SDS-PAGE - Recombinant Human CD160 protein (His tag) (AB198433)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD160 protein (His tag) (AB198433)

4-20% SDS-PAGE stained with Coomassie Blue.
Lane 1 : ab198433 (3 μg)
Lane 2 : Protein Marker

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 0.1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

O95971

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 10% Glycerol (glycerin, glycerine), 0.72% Sodium chloride, 0.71% Tris HCl, 0.03% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"15.62 kDa","actualMolecularWeight":null,"aminoAcidEnd":159,"aminoAcidStart":27,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"O95971","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD160 also known as BY55 is a glycosylphosphatidylinositol (GPI)-anchored protein with a molecular weight of approximately 27 kDa. This protein is expressed on the surface of natural killer (NK) cells CD8+ T cells and certain NKT cells. It functions as a receptor for MHC class I molecules and HLA-C playing a role in regulating immune responses. Researchers have also identified its expression in some endothelial cells.
Biological function summary

The protein CD160 plays a role in immune modulation by interacting with major histocompatibility complex (MHC) class I ligands. It participates in the immune response by enhancing cytotoxic activity in NK and CD8+ T cells therefore influencing cell-mediated immunity. CD160 does not associate with large signal transduction complexes but operates as a standalone receptor capable of mediating cellular effects upon ligand binding. Although primarily known for its role in immune modulation CD160 can impact endothelial functions suggesting a broader biological significance.

Pathways

CD160 engages in the pathway associated with immune cell signaling. It operates within the natural killer cell signaling cascade contributing to the regulation of cell-mediated cytotoxicity. In the context of adaptive immunity CD160 influences the T cell receptor signaling pathway indirectly coordinating its actions with proteins such as NKG2D and PD-1. These interactions are important in how immune cells assess threats and modulate responses.

CD160 has implications in chronic inflammatory and autoimmune conditions. It is linked to disorders such as inflammatory bowel disease and psoriasis where immune regulation is disrupted. Its interaction with other proteins such as PD-1 may either exacerbate or alleviate symptoms depending on the pathological context. Understanding CD160's role provides insights into therapeutic strategies aimed at modulating immune responses in these conditions.

Specifications

Form

Liquid

General info

Function

CD160 antigen. Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells (PubMed : 11978774, PubMed : 17307798, PubMed : 19109136). Receptor for both classical and non-classical MHC class I molecules (PubMed : 12486241, PubMed : 9973372). In the context of acute viral infection, recognizes HLA-C and triggers NK cell cytotoxic activity, likely playing a role in anti-viral innate immune response (PubMed : 12486241). On CD8+ T cells, binds HLA-A2-B2M in complex with a viral peptide and provides a costimulatory signal to activated/memory T cells (PubMed : 9973372). Upon persistent antigen stimulation, such as occurs during chronic viral infection, may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion (PubMed : 25255144). On endothelial cells, recognizes HLA-G and controls angiogenesis in immune privileged sites (PubMed : 16809620). Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (By similarity). On activated CD4+ T cells, interacts with TNFRSF14 and down-regulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response (PubMed : 18193050). In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and pro-inflammatory cytokines (By similarity).. CD160 antigen, soluble form. The soluble GPI-cleaved form, usually released by activated lymphocytes, might play an immune regulatory role by limiting lymphocyte effector functions.

Product protocols

Target data

CD160 antigen. Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells (PubMed : 11978774, PubMed : 17307798, PubMed : 19109136). Receptor for both classical and non-classical MHC class I molecules (PubMed : 12486241, PubMed : 9973372). In the context of acute viral infection, recognizes HLA-C and triggers NK cell cytotoxic activity, likely playing a role in anti-viral innate immune response (PubMed : 12486241). On CD8+ T cells, binds HLA-A2-B2M in complex with a viral peptide and provides a costimulatory signal to activated/memory T cells (PubMed : 9973372). Upon persistent antigen stimulation, such as occurs during chronic viral infection, may progressively inhibit TCR signaling in memory CD8+ T cells, contributing to T cell exhaustion (PubMed : 25255144). On endothelial cells, recognizes HLA-G and controls angiogenesis in immune privileged sites (PubMed : 16809620). Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (By similarity). On activated CD4+ T cells, interacts with TNFRSF14 and down-regulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response (PubMed : 18193050). In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and pro-inflammatory cytokines (By similarity).. CD160 antigen, soluble form. The soluble GPI-cleaved form, usually released by activated lymphocytes, might play an immune regulatory role by limiting lymphocyte effector functions.
See full target information CD160

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com