JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB112384

Recombinant Human CD163 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD163 protein (GST tag N-Terminus) is a Human Fragment protein, in the 78 to 168 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD163, M130, Scavenger receptor cysteine-rich type 1 protein M130, Hemoglobin scavenger receptor

1 Images
SDS-PAGE - Recombinant Human CD163 protein (GST tag N-Terminus) (AB112384)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD163 protein (GST tag N-Terminus) (AB112384)

ab112384 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

Q86VB7

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product is useful for Antibody Production and Protein Array.

Sequence info

[{"sequence":"NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC","proteinLength":"Fragment","predictedMolecularWeight":"35.64 kDa","actualMolecularWeight":null,"aminoAcidEnd":168,"aminoAcidStart":78,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q86VB7","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD163 known also as hemoglobin scavenger receptor is a membrane glycoprotein with a molecular weight of approximately 130 kDa. It is predominantly expressed by monocytes and macrophages which are types of immune cells. Located on the cell surface CD163 functions as a receptor that aids in the clearance of hemoglobin-haptoglobin complexes playing a critical role in maintaining iron homeostasis and protecting tissues from oxidative damage. CD163 is not limited to human cells only; researchers often study its function using animal models such as chimeric rodents and chimeric rats.
Biological function summary

CD163 participates in anti-inflammatory processes and is linked to immune modulation. It plays a pivotal role in the resolution of inflammation and promotes the removal of damaged cells and tissues. Through its involvement in the endocytic pathway CD163 interacts with various ligands facilitating interactions with other proteins. In the context of research CD163 functionality can be analyzed using techniques like CD163 IHC CD163 ELISA and CD163 stain in both human and mouse models.

Pathways

CD163 is integral to the inflammation and immune response pathways. It participates in the heme-oxygenase pathway which is essential in the breakdown of heme into biliverdin free iron and carbon monoxide. This pathway involvement is tightly linked with heme oxygenase-1 (HO-1) a cytoprotective enzyme that helps to mitigate inflammatory responses. The interaction with haptoglobin and related proteins provides further insight into its regulatory roles within the immune system.

CD163 is associated with conditions like atherosclerosis and acute inflammation disorders. Its elevated levels indicate macrophage activation observed in chronic inflammations such as cardiovascular diseases. In atherosclerosis CD163 expression correlates with the uptake of oxidized LDL connecting it to progression of the disease. Additionally soluble CD163 levels serve as a biomarker in conditions like chronic liver disease where it is linked to macrophage activation and fibrosis. Within these disorders proteins like LDL and inflammatory cytokines are closely associated with CD163 function and regulation.

Specifications

Form

Liquid

General info

Function

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.. After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.

Post-translational modifications

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.. Phosphorylated.

Product protocols

Target data

Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.. After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.
See full target information CD163

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com