JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271801

Recombinant Human CD16a (mutated F176V) protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD16a (mutated F176V) protein (Tagged) is a Human Fragment protein, in the 17 to 208 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD16a, CD16A, FCG3, FCGR3, IGFR3, FCGR3A, Low affinity immunoglobulin gamma Fc region receptor III-A, IgG Fc receptor III-A, CD16-II, CD16a antigen, Fc-gamma RIII-alpha, FcR-10, IgG Fc receptor III-2, Fc-gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcgammaRIIIA

1 Images
SDS-PAGE - Recombinant Human CD16a (mutated F176V) protein (Tagged) (AB271801)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD16a (mutated F176V) protein (Tagged) (AB271801)

SDS-PAGE analysis of 4 μg ab271801.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Avi tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P08637

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>This protein runs at a higher MW by SDS-PAGE due to glycosylation.</p>" } } }

Sequence info

[{"sequence":"GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":208,"aminoAcidStart":17,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P08637","tags":[{"tag":"Avi","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The CD16a protein also known as Fc gamma receptor IIIa (FcγRIIIa) plays an important role in the immune system. This receptor is about 50-70 kDa in mass and is expressed on the surface of natural killer (NK) cells macrophages and some T cells. CD16a facilitates antibody-dependent cellular cytotoxicity (ADCC) by binding to the Fc region of immunoglobulin G (IgG). This interaction allows effector immune cells to recognize and destroy antibody-coated target cells.
Biological function summary

CD16a is important for immune responses and occurs as part of a receptor complex. It signals downstream effects through its association with the CD3 zeta chain and the Fc epsilon receptor gamma chain which possess immunoreceptor tyrosine-based activation motifs (ITAMs). Upon binding to IgG CD16a triggers a cascade of events leading to the release of cytokines and cytotoxic granules. This action helps in eliminating infected or cancerous cells demonstrating its role in both innate and adaptive immunity.

Pathways

CD16a contributes significantly to the immunological synapse formation and NK cell activation pathway. This receptor cooperates with other proteins such as CD3 and CD19 to modulate the immune response. It also participates in signaling pathways like the PI3K-Akt pathway which regulates cell survival and proliferation. CD16a's interaction with these pathways highlights its importance in immune cell communication and function.

CD16a is linked to autoimmune diseases and certain cancers. In autoimmune disorders like systemic lupus erythematosus (SLE) abnormal CD16a function can contribute to the pathogenesis by altering immune cell targeting. Additionally in cancers such as lymphoma CD16a's interaction with IgG-coated cancer cells can influence the efficacy of monoclonal antibody therapies. The receptor's association with proteins like CD3 and CD19 in these disease contexts highlights its potential as a therapeutic target.

Specifications

Form

Liquid

General info

Function

Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (PubMed : 11711607, PubMed : 21768335, PubMed : 22023369, PubMed : 24412922, PubMed : 25786175, PubMed : 25816339, PubMed : 28652325, PubMed : 8609432, PubMed : 9242542). Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation. Involved in the generation of memory-like adaptive NK cells capable to produce high amounts of IFNG and to efficiently eliminate virus-infected cells via ADCC (PubMed : 24412922, PubMed : 25786175). Regulates NK cell survival and proliferation, in particular by preventing NK cell progenitor apoptosis (PubMed : 29967280, PubMed : 9916693). Fc-binding subunit that associates with CD247 and/or FCER1G adapters to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapters with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation. The ITAM-dependent signaling coupled to receptor phosphorylation by PKC mediates robust intracellular calcium flux that leads to production of pro-inflammatory cytokines, whereas in the absence of receptor phosphorylation it mainly activates phosphatidylinositol 3-kinase signaling leading to cell degranulation (PubMed : 1825220, PubMed : 23024279, PubMed : 2532305). Costimulates NK cells and trigger lysis of target cells independently of IgG binding (PubMed : 10318937, PubMed : 23006327). Mediates the antitumor activities of therapeutic antibodies. Upon ligation on monocytes triggers TNFA-dependent ADCC of IgG-coated tumor cells (PubMed : 27670158). Mediates enhanced ADCC in response to afucosylated IgGs (PubMed : 34485821).. (Microbial infection) Involved in Dengue virus pathogenesis via antibody-dependent enhancement (ADE) mechanism. Secondary infection with Dengue virus triggers elevated levels of afucosylated non-neutralizing IgG1s with reactivity to viral envelope/E protein. Viral antigen-IgG1 complexes bind with high affinity to FCGR3A, facilitating virus entry in myeloid cells and subsequent viral replication.

Post-translational modifications

Glycosylated. Contains high mannose- and complex-type oligosaccharides. Glycosylation at Asn-180 is mandatory for high affinity binding to the Fc and for discrimination between fucosylated and afucosylated IgG glycoforms.. Undergoes rapid ectodomain shedding upon NK cell stimulation. The soluble form is produced by a proteolytic cleavage mediated by ADAM17. Repeated stimulation causes receptor shedding, a mechanism that allows for increased NK cell motility and detachment from opsonized target cells while avoiding activation-induced NK cell apoptosis.. Phosphorylated at RSSTR motif by PKC. The relevant physiological PKCs might be PRKCI, PRKCG, PRKCE, PRKCH and PRKCQ.

Product protocols

Target data

Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (PubMed : 11711607, PubMed : 21768335, PubMed : 22023369, PubMed : 24412922, PubMed : 25786175, PubMed : 25816339, PubMed : 28652325, PubMed : 8609432, PubMed : 9242542). Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation. Involved in the generation of memory-like adaptive NK cells capable to produce high amounts of IFNG and to efficiently eliminate virus-infected cells via ADCC (PubMed : 24412922, PubMed : 25786175). Regulates NK cell survival and proliferation, in particular by preventing NK cell progenitor apoptosis (PubMed : 29967280, PubMed : 9916693). Fc-binding subunit that associates with CD247 and/or FCER1G adapters to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapters with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation. The ITAM-dependent signaling coupled to receptor phosphorylation by PKC mediates robust intracellular calcium flux that leads to production of pro-inflammatory cytokines, whereas in the absence of receptor phosphorylation it mainly activates phosphatidylinositol 3-kinase signaling leading to cell degranulation (PubMed : 1825220, PubMed : 23024279, PubMed : 2532305). Costimulates NK cells and trigger lysis of target cells independently of IgG binding (PubMed : 10318937, PubMed : 23006327). Mediates the antitumor activities of therapeutic antibodies. Upon ligation on monocytes triggers TNFA-dependent ADCC of IgG-coated tumor cells (PubMed : 27670158). Mediates enhanced ADCC in response to afucosylated IgGs (PubMed : 34485821).. (Microbial infection) Involved in Dengue virus pathogenesis via antibody-dependent enhancement (ADE) mechanism. Secondary infection with Dengue virus triggers elevated levels of afucosylated non-neutralizing IgG1s with reactivity to viral envelope/E protein. Viral antigen-IgG1 complexes bind with high affinity to FCGR3A, facilitating virus entry in myeloid cells and subsequent viral replication.
See full target information FCGR3A mutated F176V

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com