JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB270598

Recombinant Human CD19 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD19 protein (Tagged) is a Human Fragment protein, in the 160 to 258 aa range, expressed in Escherichia coli, with >80%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD19, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, Differentiation antigen CD19, T-cell surface antigen Leu-12

1 Images
SDS-PAGE - Recombinant Human CD19 protein (Tagged) (AB270598)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD19 protein (Tagged) (AB270598)

Recombinant human CD19 protein fragment (ab270598) resolved on a SDS-PAGE gel under reducing conditions.

Key facts

Purity

>80% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Escherichia coli

Tags

GST tag N-Terminus His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P15391

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Storage buffer

Constituents: PBS, 82.8% Trehalose, 0.17% Sodium-N-Lauroylsarcosinate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGK","proteinLength":"Fragment","predictedMolecularWeight":"61 kDa","actualMolecularWeight":"44 kDa","aminoAcidEnd":258,"aminoAcidStart":160,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P15391","tags":[{"tag":"GST","terminus":"N-Terminus"},{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD19 is a transmembrane protein also known as B4 or B-lymphocyte antigen CD19 with an approximate molecular weight of 95 kDa. It is expressed on the surface of B cells throughout their development from pro-B cells to mature B cells. CD19 functions mechanically as a coreceptor enhancing the sensitivity of B cell receptor (BCR) signaling. This protein plays a significant role in promoting the activation and proliferation of B cells by lowering the threshold for antigen receptor engagement.
Biological function summary

CD19 acts as an essential player in B cell signaling. CD19 integrates signals from the BCR with other coreceptors acting as a signaling hub. It participates in forming a signaling complex that includes proteins like CD21 and CD81 which further amplifies BCR-mediated signaling. This complex plays a critical role in B cell activation differentiation and survival ensuring that immune responses are efficiently mounted against pathogens.

Pathways

The CD19 protein fits into key immune response pathways such as the BCR signaling pathway and the PI3K-Akt signaling pathway. CD19 collaborates with other proteins like CD21 CD81 and PI3K within these pathways. Its interaction in the PI3K-Akt pathway for instance supports critical processes including B cell activation and homeostasis contributing to the adaptive immune response.

CD19 is connected to B cell malignancies and autoimmune diseases. B cell acute lymphoblastic leukemia (ALL) often shows aberrant CD19 expression making it a valuable target for therapeutic interventions like anti-CD19 monoclonal antibodies. Additionally overexpression or mutations of CD19 may contribute to autoimmune diseases by disrupting normal B cell regulation. CD19's connection with proteins like CD22 and CD20 in these pathological contexts highlights its relevance in developing targeted therapies.

Specifications

Form

Lyophilized

General info

Function

Functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes (PubMed : 29523808). Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (PubMed : 1373518, PubMed : 16672701, PubMed : 2463100). Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores (PubMed : 12387743, PubMed : 16672701, PubMed : 9317126, PubMed : 9382888). Is not required for early steps during B cell differentiation in the blood marrow (PubMed : 9317126). Required for normal differentiation of B-1 cells (By similarity). Required for normal B cell differentiation and proliferation in response to antigen challenges (PubMed : 1373518, PubMed : 2463100). Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge (PubMed : 12387743, PubMed : 16672701, PubMed : 9317126).

Post-translational modifications

Phosphorylated on tyrosine following B-cell activation (PubMed:10706702, PubMed:12387743, PubMed:7684160, PubMed:7687539). Phosphorylated on tyrosine residues by LYN (PubMed:7687428). Tyrosine residues are phosphorylated sequentially after activation of the B cell receptor. Phosphorylation of Tyr-531 is extremely rapid, followed by phosphorylation at Tyr-409. In contrast, phosphorylation of Tyr-500 appears more slowly and is more transient, returning rapidly to basal levels (By similarity).

Product protocols

Target data

Functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes (PubMed : 29523808). Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens (PubMed : 1373518, PubMed : 16672701, PubMed : 2463100). Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores (PubMed : 12387743, PubMed : 16672701, PubMed : 9317126, PubMed : 9382888). Is not required for early steps during B cell differentiation in the blood marrow (PubMed : 9317126). Required for normal differentiation of B-1 cells (By similarity). Required for normal B cell differentiation and proliferation in response to antigen challenges (PubMed : 1373518, PubMed : 2463100). Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge (PubMed : 12387743, PubMed : 16672701, PubMed : 9317126).
See full target information CD19

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com