JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276290

Recombinant Human CD208 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD208 protein (His tag) is a Human Fragment protein, in the 28 to 381 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD208, DCLAMP, TSC403, LAMP3, Lysosome-associated membrane glycoprotein 3, LAMP-3, Lysosomal-associated membrane protein 3, DC-lysosome-associated membrane glycoprotein, Protein TSC403, DC LAMP

1 Images
SDS-PAGE - Recombinant Human CD208 protein (His tag) (AB276290)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD208 protein (His tag) (AB276290)

SDS-PAGE analysis of ab276290

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UQV4

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT","proteinLength":"Fragment","predictedMolecularWeight":"39 kDa","actualMolecularWeight":null,"aminoAcidEnd":381,"aminoAcidStart":28,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9UQV4","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein CD208 also known as DC-LAMP or LAMP-3 is integral to the immune system. It has an approximate mass of 60 kDa. CD208 is a type I transmembrane glycoprotein found mainly in the endosomal/lysosomal compartments of dendritic cells. The expression of CD208 is upregulated during the maturation of dendritic cells making it a reliable marker for these immune cells. Researchers often use CD208 to study dendritic cell biology and its role in immune responses.
Biological function summary

CD208 participates in the regulation of the immune response by facilitating antigen processing and presentation. This protein is a part of the lysosomal-associated membrane protein family which contributes to the recycling of MHC class II molecules. Through its involvement in the endocytic pathway CD208 aids in presenting antigens to T lymphocytes an important step in triggering adaptive immunity. The protein colocalizes with MHC class II which is essential for effective antigen presentation.

Pathways

CD208 has a significant role in the endosomal-lysosomal pathway where it interacts with other proteins involved in antigen processing. It also engages in the intracellular trafficking pathway that affects the presentation of peptides on MHC class II molecules. The interaction with proteins such as HLA-DR is vital for efficient antigen presentation to helper T cells. CD208 supports the proper delivery of peptide-loaded MHC molecules to the cell surface a necessity for a functional adaptive immune response.

CD208 has implications in autoimmune diseases and infectious diseases. Its expression is notably altered in conditions like lupus and certain infectious diseases. In systemic lupus erythematosus (SLE) abnormal CD208 expression correlates with the dysregulation of immune responses. Additionally during infectious diseases changes in CD208 expression can impact the activation and function of dendritic cells affecting disease progression. The interaction of CD208 with proteins like MHC class II molecules highlights its role in disease pathology and immune regulation.

Specifications

Form

Lyophilized

General info

Function

Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction (PubMed : 25681212). Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process (PubMed : 24434718). Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway (PubMed : 29056532). May also play a role in dendritic cell function and in adaptive immunity (PubMed : 9768752).. (Microbial infection) Plays a positive role in post-entry steps of influenza A virus replication, either virus uncoating, cytosolic transport, or nuclear import of viral components, and promotes nuclear accumulation of influenza nucleoprotein/NP at early stages of viral infection.. (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.. (Microbial infection) Promotes the intracellular proliferation of Salmonella typhimuium.

Sequence similarities

Belongs to the LAMP family.

Subcellular localisation

Lysosome membrane

Product protocols

Target data

Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction (PubMed : 25681212). Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process (PubMed : 24434718). Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway (PubMed : 29056532). May also play a role in dendritic cell function and in adaptive immunity (PubMed : 9768752).. (Microbial infection) Plays a positive role in post-entry steps of influenza A virus replication, either virus uncoating, cytosolic transport, or nuclear import of viral components, and promotes nuclear accumulation of influenza nucleoprotein/NP at early stages of viral infection.. (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F.. (Microbial infection) Promotes the intracellular proliferation of Salmonella typhimuium.
See full target information LAMP3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com