JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271540

Recombinant Human CD226 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD226 protein (Tagged) is a Human Fragment protein, in the 19 to 247 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD226, DNAM1, CD226 antigen, DNAX accessory molecule 1, DNAM-1

1 Images
SDS-PAGE - Recombinant Human CD226 protein (Tagged) (AB271540)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD226 protein (Tagged) (AB271540)

SDS-PAGE analysis of ab271540.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q15762

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN","proteinLength":"Fragment","predictedMolecularWeight":"39 kDa","actualMolecularWeight":null,"aminoAcidEnd":247,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q15762","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD226 also known as DNAM-1 (DNAX Accessory Molecule-1) is a transmembrane protein expressed on the surface of various immune cells such as T cells natural killer (NK) cells and some B cells. The protein has a molecular weight of approximately 65 kDa. CD226 is part of the Ig superfamily and plays a role in the adhesion and signaling processes of immune cells. It interacts with its ligands CD112 (PVRL2) and CD155 (PVR) on target cells facilitating immune synapse formation and cytotoxic activity.
Biological function summary

CD226 is involved in immune cell activation and receptor-mediated signaling. It aids the recognition and destruction of target cells by NK cells and cytotoxic T lymphocytes through its interaction with ligand-expressing cells. CD226 does not work alone but functions as part of a complex system of co-stimulatory and inhibitory receptors balancing immune responses. Its cooperation with receptors such as CD96 and TIGIT (T cell immunoreceptor with Ig and ITIM domains) modulates the activity of immune effector cells.

Pathways

CD226 takes part in immune signaling pathways that regulate cell-mediated cytotoxicity and inflammation. It is an important component of the immune checkpoint axis interacting closely with proteins like CD96 and TIGIT within these pathways. This interaction helps determine the fate of immune responses influencing the progression or resolution of inflammatory and autoimmune conditions. CD226 plays a role in the NK cell-mediated cytotoxicity pathway and the adaptive immune response.

CD226 has been linked to autoimmune diseases such as multiple sclerosis and type 1 diabetes. Abnormal expression or function of CD226 can influence the pathogenesis of these conditions often through interactions with related proteins like TIGIT impacting immune tolerance and effector cell function. CD226's involvement in regulating immune responses highlights its importance as a potential therapeutic target in managing autoimmune and other immune-related disorders.

Specifications

Form

Liquid

General info

Function

Cell surface receptor that plays an important role in the immune system, particularly in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-cells and NK cells (PubMed : 8673704, PubMed : 9712030). Functions as a costimulatory receptor upon recognition of target cells, such as virus-infected or tumor cells. Upon binding to its ligands PVR/CD155 or NECTIN2/CD112 on target cells, promotes the cytotoxic activity of NK cells and CTLs, enhancing their ability to kill these cells (PubMed : 26755705, PubMed : 31253644, PubMed : 30591568). Mechanistically, phosphorylation by Src kinases such as LYN of FYN, enables binding to adapter GRB2, leading to activation of VAV1, PI3K and PLCG1. Promotes also activation of kinases ERK and AKT, as well as calcium fluxes (By similarity).

Post-translational modifications

PKC-mediated phosphorylation at Ser-329 is required for lipid raft recruitment (PubMed:15684041). Phosphorylation of Tyr-322 requires association with lipid rafts and allows GRB2 binding and activation of subsequent signaling (By similarity).

Product protocols

Target data

Cell surface receptor that plays an important role in the immune system, particularly in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-cells and NK cells (PubMed : 8673704, PubMed : 9712030). Functions as a costimulatory receptor upon recognition of target cells, such as virus-infected or tumor cells. Upon binding to its ligands PVR/CD155 or NECTIN2/CD112 on target cells, promotes the cytotoxic activity of NK cells and CTLs, enhancing their ability to kill these cells (PubMed : 26755705, PubMed : 31253644, PubMed : 30591568). Mechanistically, phosphorylation by Src kinases such as LYN of FYN, enables binding to adapter GRB2, leading to activation of VAV1, PI3K and PLCG1. Promotes also activation of kinases ERK and AKT, as well as calcium fluxes (By similarity).
See full target information CD226

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com