JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276353

Recombinant Human CD24 protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD24 protein (Fc Chimera) is a Human Fragment protein, in the 1 to 59 aa range, expressed in HEK 293 cells, with >92%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD24, CD24A, Signal transducer CD24, Small cell lung carcinoma cluster 4 antigen

1 Images
SDS-PAGE - Recombinant Human CD24 protein (Fc Chimera) (AB276353)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD24 protein (Fc Chimera) (AB276353)

SDS-PAGE analysis of ab276353

Key facts

Purity

>92% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"linker":null,"sequence":"MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAG","proteinLength":"Fragment","predictedMolecularWeight":"30 kDa","actualMolecularWeight":null,"aminoAcidEnd":59,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P25063","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Form
Lyophilized
Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD24 also known as heat-stable antigen or CD24A is a glycosylphosphatidylinositol (GPI)-anchored membrane protein with a molecular mass of approximately 30-50 kDa. It is expressed on the surface of many cell types including B cells T cells neutrophils and epithelial cells. CD24 plays a role in cell adhesion and signaling processes impacting immune response and cancer progression. Its expression is often used as a marker in identification and classification procedures such as flow cytometry.
Biological function summary

CD24 functions like a molecular "switch" modulating signals sent between cells. It acts as a ligand for multiple receptors and participates in cellular communication especially influencing the immune system. Part of its biological role involves interaction within cellular complexes impacting immune modulation and inflammatory responses. CD24's location at the interface of cellular microenvironments makes it critical for cellular response adaptation to varied external stimuli.

Pathways

CD24 participates in both immune signaling and cancer-related pathways. It plays a significant role in the suppression of the immune response often interacting with proteins like Siglec-10 in these pathways. CD24's involvement in these pathways contributes to cell survival and proliferation particularly within cancer development. The protein’s interaction within specified signaling pathways allows it to influence downstream targets that regulate gene expression and cellular functions.

CD24 has significant connections to cancer and inflammatory diseases. It is highly expressed in various cancers including breast and prostate cancer where it correlates with poor prognosis due to its role in apoptosis evasion and metastasis. CD24 interacts with proteins like HMGB1 and is implicated in inflammatory conditions where it modulates immune cell activity. Extensive research into CD24's involvement in these disorders may lead to targeted therapies including the development of anti-CD24 antibodies for therapeutic interventions.

General info

Function

May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells (PubMed : 11313396). In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity (By similarity).

Sequence similarities

Belongs to the CD24 family.

Post-translational modifications

Extensively O-glycosylated.

Product protocols

Target data

May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells (PubMed : 11313396). In association with SIGLEC10 may be involved in the selective suppression of the immune response to danger-associated molecular patterns (DAMPs) such as HMGB1, HSP70 and HSP90. Plays a role in the control of autoimmunity (By similarity).
See full target information CD24

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com