JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB286013

Recombinant human CD28 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human CD28 protein (Active) is a Human Fragment protein, in the 19 to 152 aa range, expressed in HEK 293 cells, with >95%, < 0.2 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD28, T-cell-specific surface glycoprotein CD28, TP44

2 Images
ELISA - Recombinant human CD28 protein (Active) (AB286013)
  • ELISA

Supplier Data

ELISA - Recombinant human CD28 protein (Active) (AB286013)

CD28 and CD80-Biotin ELISA binding activity :

Human biotinylated CD80, Fc Tag can bind to immobilized human CD28, Fc Tag at 1 μg/mL, 100 ng/well with a linear range of 0.03 – 0.81 μg/mL.

SDS-PAGE - Recombinant human CD28 protein (Active) (AB286013)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CD28 protein (Active) (AB286013)

SDS-PAGE (4-20%) : Human CD28, Fc-Tag protein was run on SDS PAGE gel under reducing (R) conditions and stained with Coomassie Blue.

Lane M : Protein Marker

Lane 1 : Biotinylated Human CD28 Fc Tag (2 μg)

Lane 2 : Human CD28 Fc Tag (2 μg).

The proteins migrate to around 55 kDa due to glycosylation.

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 0.2 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Human biotinylated CD80, Fc Tag can bind to immobilized human CD28, Fc Tag at 1 μg/mL, 100 μL/well with a linear range of 0.03 – 0.81 μg/mL.

Accession

P10747

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS, 0.1% BSA

Storage buffer

pH: 7.4 Constituents: 95% PBS, 5% Trehalose

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product is manufactured by BioVision, an Abcam company and was previously called 9237 Human CellExp™ CD28, Human Recombinant. 9237-100 is the same size as the 100 μg size of ab286013.

Sequence info

[{"sequence":"NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP","proteinLength":"Fragment","predictedMolecularWeight":"60 kDa","actualMolecularWeight":"55 kDa","aminoAcidEnd":152,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P10747","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD28 also known as T-cell-specific surface glycoprotein CD28 or TP44 plays an important role as a co-stimulatory receptor on T cells. This glycoprotein has a molecular mass of about 44 kDa and is located mainly on the cell surface of T cells. CD28 expression also occurs on thymocytes and some B cells. It forms part of the immunoglobulin superfamily featuring in significant antibody interactions. Researchers often use anti-CD28 antibodies for various immunological assays including CD28 ELISA to study its function.
Biological function summary

CD28 co-stimulates T cells after antigen presentation. It enhances T cell proliferation survival and cytokine production. CD28 functions alongside the T cell receptor (TCR) complex mediating signals that promote full T cell activation. This interaction amplifies the immune response forming an important axis of immune system communication. CD28 interacts with its ligands B7-1 (CD80) and B7-2 (CD86) found on antigen-presenting cells (APCs) illustrating its role in immune system dynamics.

Pathways

CD28 is integral to the PI3K/Akt and MAPK/ERK signaling pathways. These pathways conduct signals critical for cellular growth and survival linking CD28 to downstream transcription factors. The interaction with another protein CTLA-4 acts as a regulatory balance for CD28 signaling preventing over-activation of T cells. This balance influences immune homeostasis and tolerance providing a framework for understanding costimulatory and inhibitory signaling.

CD28's role becomes evident in autoimmune diseases and transplant rejection. Abnormal CD28 signaling links to rheumatoid arthritis where inappropriate T cell activation occurs. Similarly CD28 activity contributes to organ transplant rejection by stimulating T cell-mediated responses against transplanted tissues. CTLA-4 through regulatory feedback can modify these effects providing therapeutic target strategies for managing such disorders. Efforts to modulate CD28 activity involve developing therapeutic agents such as anti-CD28 monoclonal antibodies.

Specifications

Form

Lyophilized

General info

Function

Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed : 1650475, PubMed : 7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intracellular biochemical events that alter the gene expression program of T-cells (PubMed : 24665965). Stimulation upon engagement of its cognate ligands CD80 or CD86 increases proliferation and expression of various cytokines in particular IL2 production in both CD4(+) and CD8(+) T-cell subsets (PubMed : 1650475, PubMed : 35397202). Mechanistically, ligation induces recruitment of protein kinase C-theta/PRKCQ and GRB2 leading to NF-kappa-B activation via both PI3K/Akt-dependent and -independent pathways (PubMed : 21964608, PubMed : 24665965, PubMed : 7568038). In conjunction with TCR/CD3 ligation and CD40L costimulation, enhances the production of IL4 and IL10 in T-cells (PubMed : 8617933).. Isoform 3. Enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells (PubMed : 15067037).

Post-translational modifications

Phosphorylated by LCK (PubMed:7568038). Dephosphorylated by PTPN11 (PubMed:36114179).. Isoform 3. Tyrosine phosphorylated induced by CD40LG.

Product protocols

Target data

Receptor that plays a role in T-cell activation, proliferation, survival and the maintenance of immune homeostasis (PubMed : 1650475, PubMed : 7568038). Functions not only as an amplifier of TCR signals but delivers unique signals that control intracellular biochemical events that alter the gene expression program of T-cells (PubMed : 24665965). Stimulation upon engagement of its cognate ligands CD80 or CD86 increases proliferation and expression of various cytokines in particular IL2 production in both CD4(+) and CD8(+) T-cell subsets (PubMed : 1650475, PubMed : 35397202). Mechanistically, ligation induces recruitment of protein kinase C-theta/PRKCQ and GRB2 leading to NF-kappa-B activation via both PI3K/Akt-dependent and -independent pathways (PubMed : 21964608, PubMed : 24665965, PubMed : 7568038). In conjunction with TCR/CD3 ligation and CD40L costimulation, enhances the production of IL4 and IL10 in T-cells (PubMed : 8617933).. Isoform 3. Enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells (PubMed : 15067037).
See full target information CD28

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com