JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB167755

Recombinant human CD3 epsilon protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human CD3 epsilon protein (Active) is a Human Fragment protein, in the 23 to 126 aa range, expressed in HEK 293, with >90% purity, <1 EU/µg endotoxin level and suitable for SDS-PAGE and Functional studies.The predicted molecular weight of ab167755 protein is 16.9 kDa.

- Save time and ensure accurate results - use our recombinant human CD3 epsilon /CD3e protein as a control
- Optimal protein bioactivity and stability
- ab167755 protein is designed as a dimer

View Alternative Names

CD3e, T3E, CD3E, T-cell surface glycoprotein CD3 epsilon chain, T-cell surface antigen T3/Leu-4 epsilon chain

3 Images
Functional Studies - Recombinant human CD3 epsilon protein (Active) (AB167755)
  • FuncS

Supplier Data

Functional Studies - Recombinant human CD3 epsilon protein (Active) (AB167755)

Immobilized Mouse Anti Human CD3 at 2 μg/mL (100 μL/well) can bind ab167755 with a linear range of 0.2-2 ng/mL (QC tested).

SDS-PAGE - Recombinant human CD3 epsilon protein (Active) (AB167755)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CD3 epsilon protein (Active) (AB167755)

ab167755 on SDS-PAGE under reducing (R) and non-reducing (NR) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.

Size Exclusion Chromatography - Recombinant human CD3 epsilon protein (Active) (AB167755)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant human CD3 epsilon protein (Active) (AB167755)

The purity of Human CD3 epsilon, His Tag (ab167755) is more than 90% and the molecular weight of this protein is around 40-50 kDa verified by SEC-MALS.

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Immobilized Mouse Anti-Human CD3 at 2 μg/mL (100 μL/well) binds ab167755.

Linear range: 0.2-2 ng/mL (QC tested).

Accession

P07766

Animal free

No

Carrier free

Yes

Species

Human

Reconstitution

Reconstitute with sterile deionized water to a concentration of 600 µg/ml.

Storage buffer

pH: 7.54 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>As a result of glycosylation, the protein migrates as 20-21 kDa under reducing (R) condition, and 35-45 kDa under non-reducing (NR) condition (SDS-PAGE).</p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Ensure the validity of your result using our bioactive recombinant human CD3 epsilon /CD3e protein ab167755 as control in SDS-PAGE.


Check out our protein gel staining guide for SDS-PAGE here

Sequence info

[{"sequence":"DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD","proteinLength":"Fragment","predictedMolecularWeight":"16.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":126,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P07766","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle|For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA)|Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C.
True

Specifications

Form

Lyophilized

Additional notes

Purified by Immobilized metal affinity chromatography.

General info

Function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response (PubMed : 15294938, PubMed : 15546002, PubMed : 2470098, PubMed : 40592325, PubMed : 8490660). When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD247/CD3Z (PubMed : 2470098, PubMed : 40592325). All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain (PubMed : 2470098, PubMed : 40592325). Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed : 2470098, PubMed : 40592325). CD3E ITAM phosphorylation creates docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme (By similarity). In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development (By similarity). Also participates in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region (PubMed : 10384095, PubMed : 26507128). In addition to its role as a TCR coreceptor, it serves as a receptor for ITPRIPL1 (PubMed : 38614099). Ligand recognition inhibits T-cell activation by promoting interaction with NCK1, which prevents CD3E-ZAP70 interaction and blocks the ERK-NFkB signaling cascade and calcium influx (PubMed : 12110186, PubMed : 38614099).

Post-translational modifications

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.

Product protocols

Target data

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response (PubMed : 15294938, PubMed : 15546002, PubMed : 2470098, PubMed : 40592325, PubMed : 8490660). When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD247/CD3Z (PubMed : 2470098, PubMed : 40592325). All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain (PubMed : 2470098, PubMed : 40592325). Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways (PubMed : 2470098, PubMed : 40592325). CD3E ITAM phosphorylation creates docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme (By similarity). In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development (By similarity). Also participates in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region (PubMed : 10384095, PubMed : 26507128). In addition to its role as a TCR coreceptor, it serves as a receptor for ITPRIPL1 (PubMed : 38614099). Ligand recognition inhibits T-cell activation by promoting interaction with NCK1, which prevents CD3E-ZAP70 interaction and blocks the ERK-NFkB signaling cascade and calcium influx (PubMed : 12110186, PubMed : 38614099).
See full target information CD3E

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com