JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271435

Recombinant Human CD47 protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD47 protein (Tagged) is a Human Fragment protein, in the 19 to 139 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD47, MER6, Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3, Integrin-associated protein, Protein MER6, IAP

2 Images
SDS-PAGE - Recombinant Human CD47 protein (Tagged) (AB271435)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD47 protein (Tagged) (AB271435)

SDS-PAGE analysis of ab271435.

Size Exclusion Chromatography - Recombinant Human CD47 protein (Tagged) (AB271435)
  • Size Exclusion Chromatography

Supplier Data

Size Exclusion Chromatography - Recombinant Human CD47 protein (Tagged) (AB271435)

SEC analysis of ab271435.

Aggregation <10%.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Avi tag C-Terminus Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q08722

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP","proteinLength":"Fragment","predictedMolecularWeight":"42 kDa","actualMolecularWeight":null,"aminoAcidEnd":139,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q08722","tags":[{"tag":"Avi","terminus":"C-Terminus"},{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD47 also referred to as integrin-associated protein carries a molecular weight of approximately 50 kDa. This protein is broadly expressed across various cell types notably on erythrocytes leukocytes and endothelial cells. Its transmembrane glycoprotein structure allows it to perform various cellular functions. CD47 interacts with specific ligands prominently SIRPα which are present on immune cells such as macrophages and dendritic cells. The engagement of CD47 with these ligands plays a major role in cellular signaling processes.
Biological function summary

CD47 functions as a "don't eat me" signal inhibiting phagocytosis by binding to SIRPα on macrophages. This protein is also important for cell adhesion and migration and can modulate interactions with integrins. While not a part of a large complex CD47 associates with various cytoskeletal and membrane proteins to maintain cellular architecture and transmission of mechanical forces. Additionally its interaction with thrombospondins influences angiogenesis and nitric oxide signaling.

Pathways

CD47 is extensively involved in the regulation of the immune response and angiogenesis. The interaction between CD47 and SIRPα plays a part in the regulation of macrophage activity impacting the immune signaling pathway. CD47 also interacts with integrins allowing it to contribute to the angiogenesis pathway which is critical in the formation of new blood vessels. These interactions help coordinate complex cellular responses and maintain tissue homeostasis.

CD47 levels have associations with cancer and chronic inflammatory diseases. In cancer CD47 overexpression can allow tumor cells to evade the immune response by downregulating phagocytosis through SIRPα interaction. Therapeutically targeting CD47 using agents like anti-CD47 antibodies shows potential for enhancing anti-tumor immunity. Additionally CD47 is involved in atherosclerosis where its interaction with thrombospondin-1 contributes to disease pathogenesis by affecting nitric oxide signaling and vascular remodeling.

Specifications

Form

Liquid

General info

Function

Adhesive protein that mediates cell-to-cell interactions (PubMed : 11509594, PubMed : 15383453). Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (PubMed : 19004835, PubMed : 7691831, PubMed : 8550562). Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed : 11509594, PubMed : 15383453, PubMed : 19004835, PubMed : 27742621, PubMed : 32679764, PubMed : 7691831, PubMed : 8550562). Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed : 27742621). Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (By similarity). Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (PubMed : 11509594). Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (PubMed : 15383453). Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (By similarity). Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed : 32679764). In response to THBS1, negatively modulates wound healing (By similarity). Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (By similarity). May play a role in membrane transport and/or integrin dependent signal transduction (PubMed : 7691831). May prevent premature elimination of red blood cells (By similarity).

Product protocols

Target data

Adhesive protein that mediates cell-to-cell interactions (PubMed : 11509594, PubMed : 15383453). Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (PubMed : 19004835, PubMed : 7691831, PubMed : 8550562). Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed : 11509594, PubMed : 15383453, PubMed : 19004835, PubMed : 27742621, PubMed : 32679764, PubMed : 7691831, PubMed : 8550562). Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed : 27742621). Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (By similarity). Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (PubMed : 11509594). Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (PubMed : 15383453). Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (By similarity). Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed : 32679764). In response to THBS1, negatively modulates wound healing (By similarity). Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (By similarity). May play a role in membrane transport and/or integrin dependent signal transduction (PubMed : 7691831). May prevent premature elimination of red blood cells (By similarity).
See full target information CD47

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com