JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB180322

Recombinant Human CD5 protein (denatured) (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD5 protein (denatured) (His tag N-Terminus) is a Human Fragment protein, in the 25 to 372 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

CD5, LEU1, T-cell surface glycoprotein CD5, Lymphocyte antigen T1/Leu-1

1 Images
SDS-PAGE - Recombinant Human CD5 protein (denatured) (His tag N-Terminus) (AB180322)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD5 protein (denatured) (His tag N-Terminus) (AB180322)

15% SDS-PAGE analysis of ab180322 (3μg)

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P06127

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 2.4% Urea, 0.32% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP","proteinLength":"Fragment","predictedMolecularWeight":"41 kDa","actualMolecularWeight":null,"aminoAcidEnd":372,"aminoAcidStart":25,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P06127","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD5 also known as T1 or Leu-1 is a glycoprotein with a molecular mass of approximately 67 kDa. It is expressed mainly on the surface of T cells and a subset of B cells. CD5 plays a major role in the regulation of immune responses. It functions by modulating T-cell receptor (TCR) signaling often acting as a negative regulator to prevent excessive immune activation. Researchers often utilize CD5 antibodies such as those conjugated with PerCP for immunohistochemistry (IHC) to study this protein's expression and distribution.
Biological function summary

CD5 is essential in the immune system's ability to maintain tolerance to self-antigens thereby preventing autoimmune responses. CD5 forms part of a receptor complex on the cell surface that interacts with ligands and other receptors to fine-tune immune cell signaling. Its localization and function in T cells relate closely to its ability to modulate signaling pathways essential for cell survival and proliferation. This modulation is important for ensuring that immune responses are appropriate to the stimuli encountered.

Pathways

CD5 is involved in signal transduction processes important for immune tolerance and modulation. It intersects with pathways like the T cell receptor (TCR) signaling pathway and the NF-kB signaling pathway. These pathways involve interaction with proteins like Zap70 a tyrosine kinase related to TCR signaling and the downstream activation of transcription factors that regulate immune responses. The protein CRIS1 also appears in some pathway interactions highlighting the interconnected nature of immune regulatory proteins.

CD5 has significant associations with autoimmune diseases such as systemic lupus erythematosus (SLE) where its modulatory role can affect autoantibody production. Additionally CD5 in conjunction with proteins like OX19 correlates with certain lymphoproliferative disorders including chronic lymphocytic leukemia (CLL). In these disorders the expression and function of CD5 may impact disease progression and patient response to therapy making it a potential target for intervention in immune-related conditions.

Specifications

Form

Liquid

General info

Function

Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by interacting with several ligands expressed on B-cells such as CD5L or CD72 and thereby plays an important role in contact-mediated, T-dependent B-cell activation and in the maintenance of regulatory T and B-cell homeostasis. Functions as a negative regulator of TCR signaling during thymocyte development by associating with several signaling proteins including LCK, CD3Z chain, PI3K or CBL (PubMed : 1384049, PubMed : 1385158). Mechanistically, co-engagement of CD3 with CD5 enhances phosphorylated CBL recruitment leading to increased VAV1 phosphorylation and degradation (PubMed : 23376399). Modulates B-cell biology through ERK1/2 activation in a Ca(2+)-dependent pathway via the non-selective Ca(2+) channel TRPC1, leading to IL-10 production (PubMed : 27499044).

Post-translational modifications

Phosphorylated on serine, threonine and tyrosine residues following TCR stimulation (PubMed:1385158). Phosphorylated by LCK on Tyr-453 and Tyr-487 upon TCR engagement.

Product protocols

Target data

Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by interacting with several ligands expressed on B-cells such as CD5L or CD72 and thereby plays an important role in contact-mediated, T-dependent B-cell activation and in the maintenance of regulatory T and B-cell homeostasis. Functions as a negative regulator of TCR signaling during thymocyte development by associating with several signaling proteins including LCK, CD3Z chain, PI3K or CBL (PubMed : 1384049, PubMed : 1385158). Mechanistically, co-engagement of CD3 with CD5 enhances phosphorylated CBL recruitment leading to increased VAV1 phosphorylation and degradation (PubMed : 23376399). Modulates B-cell biology through ERK1/2 activation in a Ca(2+)-dependent pathway via the non-selective Ca(2+) channel TRPC1, leading to IL-10 production (PubMed : 27499044).
See full target information CD5

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com