JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB168079

Recombinant Human CD59 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD59 protein (His tag N-Terminus) is a Human Full Length protein, in the 26 to 102 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CD59, MIC11, MIN1, MIN2, MIN3, MSK21, CD59 glycoprotein, 1F5 antigen, 20 kDa homologous restriction factor, MAC-inhibitory protein, MEM43 antigen, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, Protectin, HRF-20, HRF20, MAC-IP, MACIF, MIRL

1 Images
SDS-PAGE - Recombinant Human CD59 protein (His tag N-Terminus) (AB168079)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD59 protein (His tag N-Terminus) (AB168079)

3 μg ab168079 on 15% SDS-PAGE

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

P13987

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN","proteinLength":"Full Length","predictedMolecularWeight":"11.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":102,"aminoAcidStart":26,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P13987","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD59 also known as protectin is a protein with a molecular mass of approximately 18-25 kDa. It is widely expressed on the surface of many human cells including red blood cells and various types of leukocytes. CD59 serves as an inhibitor of the complement membrane attack complex (MAC) preventing cell lysis caused by terminal complement proteins. Through this mechanism it regulates complement activation and maintains cell integrity by halting the formation of MAC.
Biological function summary

One important feature of CD59 is its role as a glycosylphosphatidylinositol (GPI)-anchored protein involved in safeguarding cells from complement-mediated damage. It does not exist within a larger complex but functions at the cell surface to inhibit the assembly of complement components C5b-9 which form the MAC. This ability to inhibit MAC is essential in maintaining self-tissue from unintended damage during immune responses.

Pathways

CD59 participates in the regulation of the complement cascade specifically within the terminal pathway. The complement system serves as a bridge between innate and adaptive immunity contributing to processes like opsonization and cell lysis. CD59's inhibitory action directly impacts pathways that utilize terminal components such as C5b. Effective CD59 function prevents excessive complement activation ensuring that an immune response does not damage host tissues. It links closely with other complement regulatory proteins like CD55 which also mitigate complement cascade activation.

Deficiencies or malfunctions in CD59 have notable implications. Paroxysmal nocturnal hemoglobinuria (PNH) is a disorder where lack of CD59 expression on blood cells leads to their increased destruction due to unregulated complement activity. Furthermore CD59's dysfunction or inadequacy also associates with atypical hemolytic uremic syndrome (aHUS) which involves mutant complement regulatory proteins causing overactivation of the complement system. These associations highlight the importance of CD59 in both maintaining cellular health and preventing pathophysiological conditions related to complement overactivity.

Specifications

Form

Liquid

General info

Function

Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.. The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.

Post-translational modifications

N- and O-glycosylated. The N-glycosylation mainly consists of a family of biantennary complex-type structures with and without lactosamine extensions and outer arm fucose residues. Also significant amounts of triantennary complexes (22%). Variable sialylation also present in the Asn-43 oligosaccharide. The predominant O-glycans are mono-sialylated forms of the disaccharide, Gal-beta-1,3GalNAc, and their sites of attachment are probably on Thr-76 and Thr-77. The GPI-anchor of soluble urinary CD59 has no inositol-associated phospholipid, but is composed of seven different GPI-anchor variants of one or more monosaccharide units. Major variants contain sialic acid, mannose and glucosamine. Sialic acid linked to an N-acetylhexosamine-galactose arm is present in two variants.. Glycated. Glycation is found in diabetic subjects, but only at minimal levels in nondiabetic subjects. Glycated CD59 lacks MAC-inhibitory function and confers to vascular complications of diabetes.

Product protocols

Target data

Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.. The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
See full target information CD59

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com