JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB116984

Recombinant Human CD6/T12 protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD6/T12 protein (GST tag N-Terminus) is a Human Fragment protein, in the 308 to 400 aa range, expressed in Wheat germ, suitable for SDS-PAGE, ELISA, WB.

View Alternative Names

CD6, T-cell differentiation antigen CD6, T12, TP120

1 Images
SDS-PAGE - Recombinant Human CD6/T12 protein (GST tag N-Terminus) (AB116984)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CD6/T12 protein (GST tag N-Terminus) (AB116984)

12.5% SDS-PAGE showing ab116984 at approximately 35.86kDa.
Stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

SDS-PAGE, ELISA, WB

applications

Biologically active

No

Accession

P30203

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.3% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Recombinant protein.</p>" } } }

Product details

This product was previously labelled as CD6.

Sequence info

[{"sequence":"CGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELM","proteinLength":"Fragment","predictedMolecularWeight":"35.86 kDa","actualMolecularWeight":null,"aminoAcidEnd":400,"aminoAcidStart":308,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"P30203","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD6 also known as T12 is a glycoprotein expressed on T cells and some subsets of B cells. The protein has a molecular mass of approximately 105-130 kDa. CD6 is primarily located on the surface of thymocytes mature T lymphocytes and on some B cell lines. It plays an important role in the immunological synapse serving as a receptor that aids in cell-to-cell communication during immune responses. The CD6 protein is also detectable in immune tissues including the spleen and lymph nodes.
Biological function summary

CD6 functions involve T cell maturation and proliferation. The protein is part of the lymphocyte activation complex contributing to the modulation of T cell receptor (TCR) signaling. It interacts with other cell surface proteins such as CD3 and CD28 to influence the response of T cells to antigens. CD6 potentially modulates the threshold for T cell activation favoring the adjustment of immune responses to various antigens.

Pathways

CD6 participates in the signaling pathways that regulate adaptive immune responses. It is involved in the T cell receptor (TCR) signaling pathway essential for T cell activation and differentiation. CD6 interacts with proteins like LCK and ZAP-70 which are pivotal for the TCR signaling cascade. Additionally CD6's role in immune synapse formation connects it to the modulation of cytokine production and immune cell communication.

CD6 associates with autoimmune diseases and multiple sclerosis. The protein's involvement in T cell activation and immune regulation makes it a candidate for studies targeting autoimmune pathologies. Autoimmune disorders such as rheumatoid arthritis have shown links with CD6's activity as its deregulation can lead to inappropriate immune responses. Additionally CD6's interaction with proteins like CD166 has implications in the pathogenesis of these disorders indicating a potential target for therapeutic interventions.

Specifications

Form

Liquid

General info

Function

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed : 15048703, PubMed : 15294938, PubMed : 16352806, PubMed : 16914752, PubMed : 24584089, PubMed : 24945728). Contributes to signaling cascades triggered by activation of the TCR/CD3 complex (PubMed : 24584089). Functions as a costimulatory molecule; promotes T-cell activation and proliferation (PubMed : 15294938, PubMed : 16352806, PubMed : 16914752). Contributes to the formation and maturation of the immunological synapse (PubMed : 15294938, PubMed : 16352806). Functions as a calcium-dependent pattern receptor that binds and aggregates both Gram-positive and Gram-negative bacteria. Binds both lipopolysaccharide (LPS) from Gram-negative bacteria and lipoteichoic acid from Gram-positive bacteria (PubMed : 17601777). LPS binding leads to the activation of signaling cascades and down-stream MAP kinases (PubMed : 17601777). Mediates activation of the inflammatory response and the secretion of pro-inflammatory cytokines in response to LPS (PubMed : 17601777).

Post-translational modifications

After T-cell activation, becomes hyperphosphorylated on Ser and Thr residues and phosphorylated on Tyr residues.. Glycosylated.

Product protocols

Target data

Cell adhesion molecule that mediates cell-cell contacts and regulates T-cell responses via its interaction with ALCAM/CD166 (PubMed : 15048703, PubMed : 15294938, PubMed : 16352806, PubMed : 16914752, PubMed : 24584089, PubMed : 24945728). Contributes to signaling cascades triggered by activation of the TCR/CD3 complex (PubMed : 24584089). Functions as a costimulatory molecule; promotes T-cell activation and proliferation (PubMed : 15294938, PubMed : 16352806, PubMed : 16914752). Contributes to the formation and maturation of the immunological synapse (PubMed : 15294938, PubMed : 16352806). Functions as a calcium-dependent pattern receptor that binds and aggregates both Gram-positive and Gram-negative bacteria. Binds both lipopolysaccharide (LPS) from Gram-negative bacteria and lipoteichoic acid from Gram-positive bacteria (PubMed : 17601777). LPS binding leads to the activation of signaling cascades and down-stream MAP kinases (PubMed : 17601777). Mediates activation of the inflammatory response and the secretion of pro-inflammatory cytokines in response to LPS (PubMed : 17601777).
See full target information T-cell differentiation antigen CD6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com