JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB277036

Recombinant Human CD79a + CD79b protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD79a + CD79b protein (Tagged) is a Human Fragment protein, in the 1 to 159 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD79a, IGA, MB1, CD79A, B-cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein, CD79b, B29, IGB, CD79B, B-cell antigen receptor complex-associated protein beta chain, B-cell-specific glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 protein

1 Images
SDS-PAGE - Recombinant Human CD79a + CD79b protein (Tagged) (AB277036)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD79a + CD79b protein (Tagged) (AB277036)

SDS-PAGE analysis of ab277036

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P11912

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD","proteinLength":"Fragment","predictedMolecularWeight":"20.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":159,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P40259","tags":[{"tag":"His","terminus":"C-Terminus"}]},{"sequence":null,"proteinLength":"Fragment","predictedMolecularWeight":"17.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P11912","tags":[{"tag":"DDDDK","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD79a and CD79b proteins also known as Ig-alpha and Ig-beta respectively are key components of the B-cell receptor (BCR) complex. CD79a and CD79b form a heterodimeric structure supporting antigen recognition by BCRs. CD79a and CD79b proteins both weigh approximately 47 kDa. These proteins are expressed extensively on the surface of B lymphocytes. CD79a is found not only on B cells but also on plasma cells where it plays a role in immunological pathway.
Biological function summary

CD79a and CD79b proteins are integral for the signaling cascade in B cells. These proteins form part of the B-cell receptor complex which is necessary for B-cell activation and differentiation. This complex comprising Ig-alpha and Ig-beta transduces signals after the antigen binds to the BCR. The engagement of CD79a and CD79b in the signaling complex activates downstream signaling events which regulates B cell survival proliferation and antibody production.

Pathways

CD79a and CD79b function in the B-cell receptor signaling pathway which is important for adaptive immune response. These proteins associate with other signaling molecules such as Syk tyrosine kinase to propagate the intracellular signaling cascade. CD79a and CD79b also play roles within the NF-kB signaling pathway enhancing the transcription of survival genes in B cells. Their activity affects other proteins such as BLNK which link BCR-mediated signal to other downstream pathways.

CD79a and CD79b are linked with autoimmune diseases and B-cell malignancies like non-Hodgkin's lymphoma. Dysregulation in these proteins' signaling may contribute to abnormal B-cell proliferation and survival promoting oncogenesis in lymphomas. In autoimmune disorders overactive CD79a and CD79b proteins can result in improper B-cell activation leading to autoantibody production. These associations highlight their significance in the pathology of these diseases relating them to other immune-regulatory proteins such as CD19 in these contexts.

Specifications

Form

Lyophilized

General info

Function

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.

Post-translational modifications

Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylated by LYN. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.. Arginine methylation in the ITAM domain may interfere with the binding of SYK. It promotes signals leading to B-cell differentiation (By similarity).

Product protocols

Target data

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
See full target information CD79A

Additional targets

CD79B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com