JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB227390

Recombinant Human CD79a protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD79a protein (His tag) is a Human Fragment protein, in the 33 to 143 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD79a, IGA, MB1, CD79A, B-cell antigen receptor complex-associated protein alpha chain, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein

1 Images
SDS-PAGE - Recombinant Human CD79a protein (His tag) (AB227390)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD79a protein (His tag) (AB227390)

15% SDS-PAGE analysis of 3 μg ab227390.

MW : 18-28 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P11912

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

You may be interested in:

AB309430

Human CD79a ELISA Kit

0

0 Reviews

View product

We recommend this product because it’s often used in the same experiment or related research.

We advise that you always check the datasheet to ensure it fits your experiments, or contact ourtechnical teamfor help.

Sequence info

[{"sequence":"LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRLEHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"13.6 kDa","actualMolecularWeight":null,"aminoAcidEnd":143,"aminoAcidStart":33,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P11912","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD79a also known as Ig-alpha or MB-1 is a component of the B cell antigen receptor (BCR) complex. It is a transmembrane protein with a molecular mass of approximately 47 kDa. CD79a is part of a heterodimer with CD79b and is mainly expressed on the surface of B lymphocytes. This protein plays a critical mechanical role in signaling transduction through the BCR by associating with membrane-bound immunoglobulin molecules helping to initiate the immune response upon antigen binding.
Biological function summary

This protein acts as an essential mediator in the immune system. CD79a together with CD79b forms part of the BCR complex critical for B cell development and maturation. The BCR complex activates signaling cascades that influence B cell fate decisions such as proliferation differentiation and apoptosis. By transmitting signals from the BCR CD79a helps regulate these cellular functions necessary for efficient immune defense.

Pathways

CD79a plays a pivotal role in the B cell receptor signaling pathway. This pathway involves signaling molecules such as spleen tyrosine kinase (SYK) and phosphoinositide 3-kinase (PI3K) which are activated upon BCR engagement. CD79a acts in concert with other proteins including CD79b and the IgM receptor facilitating downstream signaling cascades that ensure proper B cell responses. Its role is important for linking extracellular antigen recognition to intracellular signaling events.

CD79a is significant in conditions like B cell lymphomas and certain immunodeficiencies. Abnormal expression or mutations in CD79a are associated with some types of non-Hodgkin lymphoma. The protein's interaction with CD79b is particularly relevant as alterations in these proteins' function or expression can impact B cell development and lead to pathogenesis in lymphoproliferative disorders. Consequently CD79a serves as an important biomarker and potential therapeutic target in these diseases.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.

Post-translational modifications

Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylated by LYN. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation.. Arginine methylation in the ITAM domain may interfere with the binding of SYK. It promotes signals leading to B-cell differentiation (By similarity).

Product protocols

Target data

Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells.
See full target information CD79A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com