JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB277034

Recombinant Human CD8 alpha + CD8B protein (Tagged)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD8 alpha + CD8B protein (Tagged) is a Human Fragment protein, in the 1 to 182 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD8a, MAL, CD8A, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2

1 Images
SDS-PAGE - Recombinant Human CD8 alpha + CD8B protein (Tagged) (AB277034)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD8 alpha + CD8B protein (Tagged) (AB277034)

SDS-PAGE analysis of ab277034

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01732

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD","proteinLength":"Fragment","predictedMolecularWeight":"22.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":182,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P10966","tags":[{"tag":"DDDDK","terminus":"C-Terminus"}]},{"sequence":"MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP","proteinLength":"Fragment","predictedMolecularWeight":"21.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":170,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P10966","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD8 alpha and CD8 beta are proteins that form part of the CD8 co-receptor complex. These proteins work together to perform critical functions in the immune system by facilitating interactions with the major histocompatibility complex (MHC) class I molecules on the surface of antigen-presenting cells. The CD8 alpha (CD8A) and CD8 beta (CD8B) proteins have molecular weights of approximately 32 kDa and 37 kDa respectively. They are expressed mainly on cytotoxic T cells some natural killer cells and subsets of dendritic cells playing an important role in immune response.
Biological function summary

The CD8A and CD8B proteins function as a dimer to assist T-cell receptor (TCR) triggering and enhance TCR signaling. This interaction helps the immune system recognize and eliminate virus-infected cells and tumor cells. By forming a part of the CD8 co-receptor complex these proteins contribute to the specificity of the T-cell mediated immune response by stabilizing MHC class I-TCR interactions which ensures effective immune surveillance.

Pathways

CD8 alpha and CD8 beta proteins participate in the antigen processing and presentation pathway. This pathway involves their interaction with MHC class I molecules that are important for T-cell activation and differentiation. The CD8 co-receptor complex works closely with the TCR complex to ensure the appropriate immune responses. The involvement of proteins such as Lck a tyrosine kinase is essential in this pathway highlighting the collaborative network of proteins working together for immune function.

CD8 alpha and CD8 beta associations highlight their role in autoimmune diseases like multiple sclerosis and in various cancers. Aberrations in CD8 expression or function can result in either inadequate immune responses or inappropriate targeting of self-antigens. The relationship with proteins like PD-1 which is involved in immune checkpoint regulation indicates the relevance of CD8 proteins in developing therapeutic strategies for these conditions.

Specifications

Form

Lyophilized

General info

Function

The protein expressed by the gene CD8A is an integral membrane glycoprotein crucial for immune responses, operating mainly in T-cells as a coreceptor for MHC class I molecule : peptide complexes. These peptides originate from cytosolic proteins, unlike class II peptides, which are from extracellular proteins. CD8A interacts with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells, recruiting the Src kinase LCK to the TCR-CD3 complex. LCK phosphorylates substrates, triggering signaling pathways that lead to the production of lymphokines, enhanced motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs), thereby aiding in the recognition and elimination of infected or tumor cells. Additionally, in natural killer (NK) cells, CD8A homodimers on the cell surface provide a survival mechanism for conjugating with and lysing multiple target cells. CD8A homodimers also facilitate the survival and differentiation of activated lymphocytes into memory CD8 T-cells. This supplementary information is collated from multiple sources and compiled automatically.

Post-translational modifications

Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts.. O-glycosylated.. Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.

Product protocols

Target data

The protein expressed by the gene CD8A is an integral membrane glycoprotein crucial for immune responses, operating mainly in T-cells as a coreceptor for MHC class I molecule : peptide complexes. These peptides originate from cytosolic proteins, unlike class II peptides, which are from extracellular proteins. CD8A interacts with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells, recruiting the Src kinase LCK to the TCR-CD3 complex. LCK phosphorylates substrates, triggering signaling pathways that lead to the production of lymphokines, enhanced motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs), thereby aiding in the recognition and elimination of infected or tumor cells. Additionally, in natural killer (NK) cells, CD8A homodimers on the cell surface provide a survival mechanism for conjugating with and lysing multiple target cells. CD8A homodimers also facilitate the survival and differentiation of activated lymphocytes into memory CD8 T-cells. This supplementary information is collated from multiple sources and compiled automatically.
See full target information CD8A

Additional targets

CD8B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com