JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276345

Recombinant Human CD8 alpha protein (Fc Chimera)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD8 alpha protein (Fc Chimera) is a Human Fragment protein, in the 1 to 182 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD8a, MAL, CD8A, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2

1 Images
SDS-PAGE - Recombinant Human CD8 alpha protein (Fc Chimera) (AB276345)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD8 alpha protein (Fc Chimera) (AB276345)

SDS-PAGE analysis of ab276345

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

Fc tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P01732

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD","proteinLength":"Fragment","predictedMolecularWeight":"44.3 kDa","actualMolecularWeight":null,"aminoAcidEnd":182,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P01732","tags":[{"tag":"Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD8 alpha also known as CD8A or CD8 protein is a glycoprotein subunit expressed on the surface of cytotoxic T lymphocytes. It has a mass of approximately 32 kDa. Found on the surface cell membrane CD8 alpha functions primarily in the immune response specifically in the recognition of antigens bound to major histocompatibility complex (MHC) class I molecules. Often scientists use CD8 antibodies for detection and CD8 IHC or immunohistochemistry for localization studies.
Biological function summary

The CD8 alpha protein plays a critical role in T-cell mediated immune responses. It forms a heterodimer with the CD8 beta chain creating the CD8 alpha-beta complex that strengthens T-cell interaction with antigen-presenting cells. CD8 alpha also helps in signaling processes that activate T cells equipping them to destroy infected or malignant cells. Researchers often study CD8 alpha peptides to understand its interactions better.

Pathways

CD8 alpha is integral to the T-cell receptor signaling pathway and the cytotoxic T lymphocyte (CTL) pathway. The T-cell receptor complex which includes the CD8 molecule transmits signals that are important for T-cell activation and function. CD8 interacts with key proteins such as the T-cell receptor (TCR) and MHC class I molecules facilitating targeted responses against pathogens. These pathways highlight CD8 alpha’s role in adaptive immunity.

CD8 alpha is most prominently associated with viral infections and cancer. Conditions like HIV and some forms of leukemia show altered CD8 function highlighting the protein's role in immune surveillance. In HIV infection for instance CD8 T cells reduce in number impairing the immune response. CD8 alpha’s connection to the immune system places it alongside other immune proteins such as CD4 and MHC molecules in the context of immune dysfunction.

Specifications

Form

Lyophilized

General info

Function

The protein expressed by the gene CD8A is an integral membrane glycoprotein crucial for immune responses, operating mainly in T-cells as a coreceptor for MHC class I molecule : peptide complexes. These peptides originate from cytosolic proteins, unlike class II peptides, which are from extracellular proteins. CD8A interacts with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells, recruiting the Src kinase LCK to the TCR-CD3 complex. LCK phosphorylates substrates, triggering signaling pathways that lead to the production of lymphokines, enhanced motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs), thereby aiding in the recognition and elimination of infected or tumor cells. Additionally, in natural killer (NK) cells, CD8A homodimers on the cell surface provide a survival mechanism for conjugating with and lysing multiple target cells. CD8A homodimers also facilitate the survival and differentiation of activated lymphocytes into memory CD8 T-cells. This supplementary information is collated from multiple sources and compiled automatically.

Post-translational modifications

Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts.. O-glycosylated.. Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.

Product protocols

Target data

The protein expressed by the gene CD8A is an integral membrane glycoprotein crucial for immune responses, operating mainly in T-cells as a coreceptor for MHC class I molecule : peptide complexes. These peptides originate from cytosolic proteins, unlike class II peptides, which are from extracellular proteins. CD8A interacts with the T-cell receptor (TCR) and MHC class I proteins on antigen-presenting cells, recruiting the Src kinase LCK to the TCR-CD3 complex. LCK phosphorylates substrates, triggering signaling pathways that lead to the production of lymphokines, enhanced motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs), thereby aiding in the recognition and elimination of infected or tumor cells. Additionally, in natural killer (NK) cells, CD8A homodimers on the cell surface provide a survival mechanism for conjugating with and lysing multiple target cells. CD8A homodimers also facilitate the survival and differentiation of activated lymphocytes into memory CD8 T-cells. This supplementary information is collated from multiple sources and compiled automatically.
See full target information CD8A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com