JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB233600

Recombinant Human CD8 beta protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD8 beta protein (His tag) is a Human Fragment protein, in the 22 to 170 aa range, expressed in Baculovirus infected insect cells, with >85%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD8b, CD8B1, CD8B, T-cell surface glycoprotein CD8 beta chain

1 Images
SDS-PAGE - Recombinant Human CD8 beta protein (His tag) (AB233600)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD8 beta protein (His tag) (AB233600)

15% SDS-PAGE analysis of 3 μg ab233600.

MW : 18-28 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>85% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10966

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"17.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":170,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P10966","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The target CD8 beta also known as CD8b or CD8B is a protein component of the CD8 coreceptor that is primarily expressed on the surface of cytotoxic T lymphocytes and a subset of natural killer cells. The CD8 beta molecule pairs with CD8 alpha to form a heterodimer that plays an essential role in the immune response. The molecular weight of CD8 beta is approximately 34 kDa. It is located primarily in the plasma membrane where it interacts with major histocompatibility complex (MHC) class I molecules.
Biological function summary

The CD8 beta protein works as part of the CD8 coreceptor complex which enhances the interaction between T cell receptors (TCRs) and antigens presented by MHC class I on infected or malignant cells. This interaction strengthens the activation signal received by T cells. The CD8 complex including CD8 beta contributes to the recognition and elimination of cells presenting foreign antigens which is essential for the adaptive immune response.

Pathways

The CD8 beta protein participates in pathways related to antigen recognition and T cell receptor signaling. The protein together with CD8 alpha facilitates signal transduction following TCR engagement. This action is vital for the activation of cytotoxic T cells enabling immune responses. CD8 beta associates with the Lck kinase another vital player in the TCR signaling pathway through its cytoplasmic tail. In this pathway the presence of CD8 beta helps maintain and modulate effective immune responses.

CD8 beta plays a significant role in conditions like viral infections and autoimmune diseases. In viral infections the presence of the CD8 complex containing CD8 beta aids in the destruction of virus-infected cells. In autoimmune diseases abnormal CD8 T cell responses can result in self-tissue damage reflecting dysregulation in its normal function. CD8 beta therefore proves critical in these contexts contributing to disease dynamics by interacting with proteins like MHC class I and Lck kinase during improper immune responses.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule : peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.

Post-translational modifications

Phosphorylated as a consequence of T-cell activation.. Palmitoylated at the cytoplasmic tail and thereby targets the heterodimer CD8A/CD8B to lipid rafts unlike CD8A homodimers.

Product protocols

Target data

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule : peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. A palmitoylation site in the cytoplasmic tail of CD8B chain contributes to partitioning of CD8 into the plasma membrane lipid rafts where signaling proteins are enriched. Once LCK recruited, it initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical role in thymic selection of CD8+ T-cells.
See full target information CD8B

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com