JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB227403

Recombinant human CD80 protein (His tag C-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant human CD80 protein (His tag C-Terminus) is a Human Fragment protein, in the 35 to 243 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, FuncS.

View Alternative Names

CD80, CD28LG, CD28LG1, LAB7, T-lymphocyte activation antigen CD80, Activation B7-1 antigen, BB1, CTLA-4 counter-receptor B7.1, B7

2 Images
Biological Activity - Recombinant human CD80 protein (His tag C-Terminus) (AB227403)
  • Biological Activity

Supplier Data

Biological Activity - Recombinant human CD80 protein (His tag C-Terminus) (AB227403)

Human CD80 (ab227403) coated at 1 μg/mL (100 μL/well) can bind CD28 in a Functional ELISA assay.

SDS-PAGE - Recombinant human CD80 protein (His tag C-Terminus) (AB227403)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CD80 protein (His tag C-Terminus) (AB227403)

15% SDS-PAGE analysis of 3 μg ab227403.

MW : 28-40 kDa (SDS-PAGE under reducing conditions).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA with Human CD28.

Accession

P33681

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLEHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"24.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":243,"aminoAcidStart":35,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"P33681","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD80 also known as B7-1 is a cell surface protein with a molecular weight of approximately 60 kDa. It is expressed on antigen-presenting cells such as dendritic cells macrophages and B cells. The CD80 protein plays a mechanical role in immune response modulation by providing necessary signals for T cell activation and survival. CD80 interacts with receptors CD28 and CTLA-4 on T cells serving as a costimulatory molecule important for productive immune responses.
Biological function summary

CD80 plays a significant role in the immune system's ability to distinguish between self and non-self. It belongs to the B7 family and participates in the formation of immunological synapses between T cells and antigen-presenting cells. This interaction is essential for triggering T cell proliferation and cytokine production forming a part of the adaptive immune response. CD80's expression increases in response to pathogen recognition enhancing the immune system's efficiency.

Pathways

CD80 is integral to the regulation of T cell-mediated immune responses. It is involved in the CD28 co-stimulatory pathway which is vital for T cell activation and function. In this pathway CD80 interacts with proteins like CD28 and CTLA-4 to modulate immune activation and regulate immune tolerance. The proper function of CD80 within this pathway ensures a balanced immune reaction preventing autoimmunity while allowing effective defense against pathogens.

CD80 plays a role in autoimmune conditions and transplantation rejection. Its overexpression or dysregulation can contribute to diseases such as rheumatoid arthritis where it modifies T cell response and inflammation. Additionally CD80 is implicated in organ transplantation influencing graft rejection outcomes due to its role in modulating immune activation. Understanding CD80 interactions with CTLA-4 and CD28 offers insight into these conditions providing potential targets for therapeutic intervention.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation (PubMed : 38467718). Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with the CD28 receptor which is constitutively expressed on the cell surface of T-cells (PubMed : 12196291). In turn, activates different signaling pathways such as NF-kappa-B or MAPK leading to the production of different cytokines (PubMed : 10438913). In addition, CD28/CD80 costimulatory signal stimulates glucose metabolism and ATP synthesis of T-cells by activating the PI3K/Akt signaling pathway (PubMed : 12121659). Acts also as a regulator of PDL1/PDCD1 interactions to limit excess engagement of PDL1 and its inhibitory role in immune responses (PubMed : 36727298). Expressed on B-cells, plays a critical role in regulating interactions between B-cells and T-cells in both early and late germinal center responses, which are crucial for the generation of effective humoral immune responses (By similarity).. (Microbial infection) Acts as a receptor for adenovirus subgroup B.

Post-translational modifications

Palmitoylated by ZDHHC20; palmitoylation protects CD80 from ubiquitin-mediated degradation, regulating the protein stability, and ensures its accurate plasma membrane localization.

Product protocols

Target data

Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation (PubMed : 38467718). Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells together with the CD28 receptor which is constitutively expressed on the cell surface of T-cells (PubMed : 12196291). In turn, activates different signaling pathways such as NF-kappa-B or MAPK leading to the production of different cytokines (PubMed : 10438913). In addition, CD28/CD80 costimulatory signal stimulates glucose metabolism and ATP synthesis of T-cells by activating the PI3K/Akt signaling pathway (PubMed : 12121659). Acts also as a regulator of PDL1/PDCD1 interactions to limit excess engagement of PDL1 and its inhibitory role in immune responses (PubMed : 36727298). Expressed on B-cells, plays a critical role in regulating interactions between B-cells and T-cells in both early and late germinal center responses, which are crucial for the generation of effective humoral immune responses (By similarity).. (Microbial infection) Acts as a receptor for adenovirus subgroup B.
See full target information CD80

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Journal of experimental & clinical cancer research : CR 42:162 PubMed37420300

2023

Cellular hierarchy framework based on single-cell/multi-patient sample sequencing reveals metabolic biomarker PYGL as a therapeutic target for HNSCC.

Applications

Unspecified application

Species

Unspecified reactive species

Jiezhong Guan,Xi Xu,Guo Qiu,Chong He,Xiaoyue Lu,Kang Wang,Xinyu Liu,Yuanyuan Li,Zihang Ling,Xuan Tang,Yujie Liang,Xiaoan Tao,Bin Cheng,Bo Yang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com