JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB276475

Recombinant Human CD82 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD82 protein (His tag) is a Human Fragment protein, in the 111 to 228 aa range, expressed in HEK 293 cells, with >90%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD82, KAI1, SAR2, ST6, TSPAN27, CD82 antigen, C33 antigen, IA4, Inducible membrane protein R2, Metastasis suppressor Kangai-1, Suppressor of tumorigenicity 6 protein, Tetraspanin-27, Tspan-27

1 Images
SDS-PAGE - Recombinant Human CD82 protein (His tag) (AB276475)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD82 protein (His tag) (AB276475)

SDS-PAGE analysis of ab276475

Key facts

Purity

>90% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P27701

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 100% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL","proteinLength":"Fragment","predictedMolecularWeight":"15 kDa","actualMolecularWeight":null,"aminoAcidEnd":228,"aminoAcidStart":111,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P27701","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Ambient - Can Ship with Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD82 also known as KAI1 is a member of the tetraspanin family of proteins. It has a molecular mass of approximately 29 to 30 kDa. This protein is widely expressed on the surface of various cell types such as epithelial cells lymphocytes and endothelial cells. It features four transmembrane domains implying a role in organizing membrane microdomains. CD82 is known for its role in promoting cell adhesion and motility through its involvement in protein-protein interactions on the cell surface.
Biological function summary

CD82 plays a significant role in regulating cell signaling and communication during tumor progression and metastasis. It participates in the formation of tetraspanin-enriched microdomains by associating with other tetraspanins and integrins influencing the cellular microenvironment. Additionally CD82 impacts immune cell interactions by modulating activities of T cells and B cells. Despite not being the predominant component in any major protein complex CD82 influences many cellular processes by regulating diverse signaling pathways.

Pathways

CD82 modulates both the PI3K-Akt signaling pathway and the Wnt signaling pathway. These pathways are critical in controlling cellular processes like growth and survival contributing to the metastasis-suppressive effects of CD82. In these contexts CD82 associates with proteins such as integrins and cadherins which facilitate its regulation of signal transduction and cellular dynamics. CD82's role in these pathways shows its importance in controlling cancer cell behavior and immune system interactions.

CD82 has been linked to various cancers particularly prostate cancer and melanoma. Its downregulation or loss often correlates with tumor progression and metastasis indicating its function as a metastasis suppressor. In cancer CD82 interacts with proteins like epidermal growth factor receptor (EGFR) and other integrins affecting disease progression by altering cell adhesion migration and invasion. CD82’s expression level serves as a potential biomarker for cancer prognosis and treatment outcomes.

Specifications

Form

Lyophilized

General info

Function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 19497983). Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking. Acts as a attenuator of EGF signaling, facilitating ligand-induced endocytosis of the receptor and its subsequent desensitization (PubMed : 10985391, PubMed : 35538033). Mechanistically, modulates ligand-induced ubiquitination and trafficking of EGFR via E3 ligase CBL phosphorylation by PKC (PubMed : 23897813). Increases cell-matrix adhesion by regulating the membrane organization of integrin alpha4/ITA4 (PubMed : 24623721, PubMed : 8757325). Modulates adhesion and suppresses cell migration through other integrins such as the alpha6/ITGA6 and beta1/ITGB1 (PubMed : 15557282, PubMed : 17560548). Decreases cell-associated plasminogen activation by interfering with the interaction between urokinase-type plasminogen activator/PLAU and its receptor PLAUR (PubMed : 15677461). Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway. Plays a role in TLR9 trafficking to acidified CpG-containing compartments by controlling interaction between TLR9 and VAMP3 and subsequent myddosome assembly (By similarity). Inhibits LPS-induced inflammatory response by preventing binding of LPS to TLR4 on the cell surface (PubMed : 36945827). Plays a role in the activation of macrophages into anti-inflammatory phenotypes (By similarity). Independently of Toll-like receptor (TLR) signaling, is recruited to pathogen-containing phagosomes prior to fusion with lysosomes and thereby participates in antigen presentation (By similarity). Acts also to control angiogenesis and switch angiogenic milieu to quiescent state by binding and sequestering VEGFA and PDGFB to inhibit the signaling they trigger via their respective cell surface receptor (PubMed : 34530889).

Sequence similarities

Belongs to the tetraspanin (TM4SF) family.

Post-translational modifications

Palmitoylated. Palmitoylation contributes to oligomerization and surface expression.

Product protocols

Target data

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed : 19497983). Participates thereby in diverse biological functions such as cell signal transduction, adhesion, migration and protein trafficking. Acts as a attenuator of EGF signaling, facilitating ligand-induced endocytosis of the receptor and its subsequent desensitization (PubMed : 10985391, PubMed : 35538033). Mechanistically, modulates ligand-induced ubiquitination and trafficking of EGFR via E3 ligase CBL phosphorylation by PKC (PubMed : 23897813). Increases cell-matrix adhesion by regulating the membrane organization of integrin alpha4/ITA4 (PubMed : 24623721, PubMed : 8757325). Modulates adhesion and suppresses cell migration through other integrins such as the alpha6/ITGA6 and beta1/ITGB1 (PubMed : 15557282, PubMed : 17560548). Decreases cell-associated plasminogen activation by interfering with the interaction between urokinase-type plasminogen activator/PLAU and its receptor PLAUR (PubMed : 15677461). Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway. Plays a role in TLR9 trafficking to acidified CpG-containing compartments by controlling interaction between TLR9 and VAMP3 and subsequent myddosome assembly (By similarity). Inhibits LPS-induced inflammatory response by preventing binding of LPS to TLR4 on the cell surface (PubMed : 36945827). Plays a role in the activation of macrophages into anti-inflammatory phenotypes (By similarity). Independently of Toll-like receptor (TLR) signaling, is recruited to pathogen-containing phagosomes prior to fusion with lysosomes and thereby participates in antigen presentation (By similarity). Acts also to control angiogenesis and switch angiogenic milieu to quiescent state by binding and sequestering VEGFA and PDGFB to inhibit the signaling they trigger via their respective cell surface receptor (PubMed : 34530889).
See full target information CD82

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com