JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB219484

Recombinant Human CD84 protein (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD84 protein (His tag) is a Human Fragment protein, in the 22 to 225 aa range, expressed in Baculovirus infected insect cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE.

View Alternative Names

CD84, SLAMF5, SLAM family member 5, Cell surface antigen MAX.3, Hly9-beta, Leukocyte differentiation antigen CD84, Signaling lymphocytic activation molecule 5

1 Images
SDS-PAGE - Recombinant Human CD84 protein (His tag) (AB219484)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD84 protein (His tag) (AB219484)

15% SDS-PAGE analysis of ab219484 (3μg).

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

Baculovirus infected insect cells

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UIB8

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 10% Glycerol (glycerin, glycerine)

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADPKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"23.8 kDa","actualMolecularWeight":null,"aminoAcidEnd":225,"aminoAcidStart":22,"nature":"Recombinant","expressionSystem":"Baculovirus infected insect cells","accessionNumber":"Q9UIB8","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD84 also known as SLAMF5 is a cell surface glycoprotein with a molecular weight of approximately 64 kDa. It belongs to the signaling lymphocyte activation molecule (SLAM) family. CD84 is expressed on various immune cells including B cells T cells dendritic cells monocytes and platelets. This protein plays a role in cell signaling facilitating interactions between immune cells by acting as a homophilic receptor.
Biological function summary

CD84 contributes to the regulation of immune responses and intercellular communication. It is a part of the SLAM family which involves a signaling complex known as SLAM-associated protein (SAP) pathway. CD84 aids in the modulation of cell survival cytokine production and calcium mobilization thereby influencing immune cell function and maintenance.

Pathways

CD84 plays a role in key immune signaling pathways including the SAP signaling network and T-cell receptor pathways. CD84 interacts closely with SAP and other related proteins such as SLAM and 2B4 which help propagate T-cell activation signals and influence immune regulation. This position underlines CD84's engagement in regulating immune surveillance and homeostasis.

CD84 has been implicated in autoimmune conditions and hematological malignancies. For instance it associates with systemic lupus erythematosus where altered expression may contribute to dysregulated immune responses. CD84 also plays a role in chronic lymphocytic leukemia correlating with disease progression and immune evasion. Its connection with proteins like SLAMF6 and SAP further highlights CD84's involvement in these pathological conditions.

Specifications

Form

Liquid

Additional notes

Affinity purified

General info

Function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Can mediate natural killer (NK) cell cytotoxicity dependent on SH2D1A and SH2D1B (By similarity). Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seem be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A-dependent pathway. May serve as a marker for hematopoietic progenitor cells (PubMed : 11564780, PubMed : 12115647, PubMed : 12928397, PubMed : 12962726, PubMed : 16037392) Required for a prolonged T-cell : B-cell contact, optimal T follicular helper function, and germinal center formation. In germinal centers involved in maintaining B-cell tolerance and in preventing autoimmunity (By similarity). In mast cells negatively regulates high affinity immunoglobulin epsilon receptor signaling; independent of SH2D1A and SH2D1B but implicating FES and PTPN6/SHP-1 (PubMed : 22068234). In macrophages enhances LPS-induced MAPK phosphorylation and NF-kappaB activation and modulates LPS-induced cytokine secretion; involving ITSM 2 (By similarity). Positively regulates macroautophagy in primary dendritic cells via stabilization of IRF8; inhibits TRIM21-mediated proteasomal degradation of IRF8 (PubMed : 29434592).

Post-translational modifications

Phosphorylated by tyrosine-protein kinase LCK on tyrosine residues following ligation induced by agonist monoclonal antibody. The association with SH2D1A is dependent of tyrosine phosphorylation of its cytoplasmic domain. Phosphorylated on Tyr-296 and Tyr-316 following platelet aggregation. Phosphorylated on tyrosine residues upon high affinity immunoglobulin epsilon receptor aggregation in mast cells.. N-glycosylated.

Product protocols

Target data

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Can mediate natural killer (NK) cell cytotoxicity dependent on SH2D1A and SH2D1B (By similarity). Increases proliferative responses of activated T-cells and SH2D1A/SAP does not seem be required for this process. Homophilic interactions enhance interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A-dependent pathway. May serve as a marker for hematopoietic progenitor cells (PubMed : 11564780, PubMed : 12115647, PubMed : 12928397, PubMed : 12962726, PubMed : 16037392) Required for a prolonged T-cell : B-cell contact, optimal T follicular helper function, and germinal center formation. In germinal centers involved in maintaining B-cell tolerance and in preventing autoimmunity (By similarity). In mast cells negatively regulates high affinity immunoglobulin epsilon receptor signaling; independent of SH2D1A and SH2D1B but implicating FES and PTPN6/SHP-1 (PubMed : 22068234). In macrophages enhances LPS-induced MAPK phosphorylation and NF-kappaB activation and modulates LPS-induced cytokine secretion; involving ITSM 2 (By similarity). Positively regulates macroautophagy in primary dendritic cells via stabilization of IRF8; inhibits TRIM21-mediated proteasomal degradation of IRF8 (PubMed : 29434592).
See full target information CD84

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com