JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271376

Recombinant Human CD86 protein (Tagged) (Biotin)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD86 protein (Tagged) (Biotin) is a Human Fragment protein, in the 20 to 239 aa range, expressed in HEK 293 cells, with >90%, suitable for SDS-PAGE.

View Alternative Names

CD86, CD28LG2, T-lymphocyte activation antigen CD86, Activation B7-2 antigen, B70, BU63, CTLA-4 counter-receptor B7.2, FUN-1

1 Images
SDS-PAGE - Recombinant Human CD86 protein (Tagged) (Biotin) (AB271376)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CD86 protein (Tagged) (Biotin) (AB271376)

SDS-PAGE analysis of 10 μg ab271376.

This protein runs at a higher MW due to glycosylation.

Key facts

Purity

>90% SDS-PAGE

Expression system

HEK 293 cells

Tags

Avi tag C-Terminus DDDDK tag C-Terminus His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Conjugation

Biotin

Excitation/Emission
Accession

P42081

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.13% Sodium phosphate, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Enzymatically biotin-labeled using Avi-tag™ technology

Sequence info

[{"sequence":"LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDP","proteinLength":"Fragment","predictedMolecularWeight":"30 kDa","actualMolecularWeight":null,"aminoAcidEnd":239,"aminoAcidStart":20,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P42081","tags":[{"tag":"Avi","terminus":"C-Terminus"},{"tag":"DDDDK","terminus":"C-Terminus"},{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle|Store in the dark
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD86 also known as B7-2 is a protein involved in the regulation of the immune response. It has an approximate mass of 70 kDa and is expressed on antigen-presenting cells like dendritic cells monocytes and macrophages. Notably CD86 is present on macrophages including those in tissues such as skin and lymphoid organs. Expressed on these cells CD86 serves as a vital mediator in the co-stimulatory signals necessary for T cell activation and survival.
Biological function summary

CD86 plays a significant role in the immune system by providing secondary signals for T cell activation and differentiation. It is a part of the B7 protein family and forms a complex with CD28 and CTLA-4 on T cells. When CD86 binds to CD28 it sends positive co-stimulatory signals which promote T cell proliferation and cytokine production. On the other hand interaction with CTLA-4 transmits an inhibitory signal which reduces immune response. This dual interaction helps to balance immune activation and tolerance.

Pathways

CD86 takes part in important immune-related signaling pathways particularly the T cell receptor signaling pathway and the PI3K-Akt signaling pathway. Both pathways are fundamental for initiating immune responses. CD86's interaction with CD28 activates downstream signaling cascades including PI3K-Akt which is important for cell survival and growth. Additionally CD86 collaborates with other proteins such as CD80 another co-stimulatory molecule to amplify T cell activation within these pathways.

CD86 is associated with autoimmune diseases and transplant rejection. In autoimmune diseases like rheumatoid arthritis the overexpression or dysregulation of CD86 can lead to excessive T cell activation causing immune system attacks on the body's own tissues. Similarly in transplant rejection CD86 may contribute by enhancing immune response against transplanted organs. The engagement between CD86 and CD28 is a critical factor in these conditions and therapies targeting this interaction are under exploration to mitigate the immune response.

Specifications

Form

Liquid

General info

Function

Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4 (PubMed : 12196291). May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation (PubMed : 7527824). Also involved in the regulation of B cells function, plays a role in regulating the level of IgG(1) produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation (By similarity).. Isoform 2. Interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.. (Microbial infection) Acts as a receptor for adenovirus subgroup B.

Post-translational modifications

Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation.

Product protocols

Target data

Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4 (PubMed : 12196291). May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation (PubMed : 7527824). Also involved in the regulation of B cells function, plays a role in regulating the level of IgG(1) produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation (By similarity).. Isoform 2. Interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.. (Microbial infection) Acts as a receptor for adenovirus subgroup B.
See full target information CD86

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com