JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB151854

Recombinant Human CD93 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CD93 protein is a Human Fragment protein, in the 24 to 580 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/µg endotoxin level, suitable for SDS-PAGE, HPLC.

View Alternative Names

CD93, C1QR1, MXRA4, Complement component C1q receptor, C1q/MBL/SPA receptor, CDw93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4, C1qR, C1qR(p), C1qRp

Key facts

Purity

>95% SDS-PAGE

Endotoxin level

< 1 EU/µg

Expression system

HEK 293 cells

Tags

His tag C-Terminus

Applications

HPLC, SDS-PAGE

applications

Biologically active

No

Accession

Q9NPY3

Animal free

No

Carrier free

No

Species

Human

Reconstitution

Reconstitute in PBS

Storage buffer

pH: 7.4 Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "HPLC": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKVDHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":"59 kDa","actualMolecularWeight":null,"aminoAcidEnd":580,"aminoAcidStart":24,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"Q9NPY3","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
A few weeks
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CD93 also known as C1q receptor and a type I transmembrane glycoprotein weighs approximately 68 kDa. This protein is mainly expressed on platelets monocytes endothelial cells and some cell lines within the immune system. CD93 is known for engaging in cell adhesion and phagocytosis processes. It has a notable presence on the surface of circulating cells indicating its involvement in physiological interactions essential for cellular communication.
Biological function summary

CD93 contributes to cellular processes through its role in the clearance of apoptotic cells and immune surveillance. It also partakes in angiogenesis facilitating the growth of new blood vessels. CD93 often functions as part of a larger complex in binding with other molecules to support cellular communication. By modulating the immune response CD93 ensures efficient removal of cellular debris maintaining homeostasis and preventing autoimmune reactions.

Pathways

CD93 operates within the innate immune response and complement system pathways. It closely interacts with other proteins such as C1q which is part of the complement activation pathway. This interaction supports the clearance of immune complexes and cellular debris. By facilitating these processes CD93 aids in maintaining the balance between immune activation and tolerance.

CD93 has associations with inflammatory diseases and cancer progression. In inflammatory diseases its role in the immune system implicates it in conditions characterized by excessive inflammation often relating to the misregulation of immune functions. As for cancer CD93's involvement in angiogenesis links it to tumor growth with connections seen alongside vascular endothelial growth factor (VEGF) pathways. These insights into CD93's role suggest its potential as a therapeutic target in treating related pathological states.

Specifications

Form

Lyophilized

Additional notes

Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

General info

Function

Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a receptor for defense collagens including surfactant protein A/SFTPA1, C1q, and mannose-binding lectin (MBL2) (PubMed : 7977768). Plays a role in the regulation of endothelial cell function and adhesion by activating angiogenesis (PubMed : 24809468). Mechanistically, exerts its angiogenic function by associating with beta-dystroglycan, leading to SRC-dependent phosphorylation and subsequent recruitment of CBL. In turn, CBL provides a docking site for downstream signaling components, such as CRKL to enhance cell migration (PubMed : 26848865). Participates in angiogenesis also by acting as a receptor for the ECM pan-endothelial glycoprotein multimerin-2/MMRN2 and IGFBP7 ligands (PubMed : 28671670, PubMed : 36265539, PubMed : 38218180). Both ligands play a non-redundant role in CD93-mediated endothelial cell function (PubMed : 38218180). Acts as a key regulator of endothelial barrier function through modulating VEGFR2 function (By similarity).

Post-translational modifications

N- and O-glycosylated.. Phosphorylated on Tyr-628 and Tyr-644 by SRC; these phosphorylations promote endothelial cell adhesion and migration.

Product protocols

Target data

Cell surface receptor that plays a role in various physiological processes including inflammation, phagocytosis, and cell adhesion. Plays a role in phagocytosis and enhances the uptake of apoptotic cells and immune complexes by acting as a receptor for defense collagens including surfactant protein A/SFTPA1, C1q, and mannose-binding lectin (MBL2) (PubMed : 7977768). Plays a role in the regulation of endothelial cell function and adhesion by activating angiogenesis (PubMed : 24809468). Mechanistically, exerts its angiogenic function by associating with beta-dystroglycan, leading to SRC-dependent phosphorylation and subsequent recruitment of CBL. In turn, CBL provides a docking site for downstream signaling components, such as CRKL to enhance cell migration (PubMed : 26848865). Participates in angiogenesis also by acting as a receptor for the ECM pan-endothelial glycoprotein multimerin-2/MMRN2 and IGFBP7 ligands (PubMed : 28671670, PubMed : 36265539, PubMed : 38218180). Both ligands play a non-redundant role in CD93-mediated endothelial cell function (PubMed : 38218180). Acts as a key regulator of endothelial barrier function through modulating VEGFR2 function (By similarity).
See full target information CD93

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com