JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB87713

Recombinant Human CDC42 protein (T7 tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CDC42 protein (T7 tag N-Terminus) is a Human Full Length protein, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, WB.

View Alternative Names

Cell division control protein 42 homolog, G25K GTP-binding protein, CDC42

3 Images
Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)
  • WB

Unknown

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)

All lanes:

Western blot - Anti-CDC42 antibody (<a href='/en-us/products/primary-antibodies/cdc42-antibody-ab64533'>ab64533</a>) at 1 µg/mL

Lane 1:

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (ab87713) at 0.1 µg

Lane 2:

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (ab87713) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 21 kDa

true

Exposure time: 1min

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)
  • WB

Unknown

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)

All lanes:

Western blot - Anti-CDC42 antibody (<a href='/en-us/products/primary-antibodies/cdc42-antibody-ab64533'>ab64533</a>) at 1 µg/mL

Lane 1:

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (ab87713) at 0.1 µg

Lane 2:

Western blot - Recombinant Human CDC42 protein (T7 tag N-Terminus) (ab87713) at 0.01 µg

Secondary

All lanes:

Western blot - Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (<a href='/en-us/products/secondary-antibodies/goat-rabbit-igg-h-l-hrp-preadsorbed-ab97080'>ab97080</a>) at 1/5000 dilution

Predicted band size: 21 kDa

true

Exposure time: 1min

SDS-PAGE - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CDC42 protein (T7 tag N-Terminus) (AB87713)

15% SDS-PAGE showing ab87713 at approximately 22.4kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

T7 tag N-Terminus

Applications

WB, SDS-PAGE

applications

Biologically active

No

Accession

P60953

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl, 0.0584% EDTA, 0.0154% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>ab87713 can be used as a WB positive control in conjunction with <a href='/en-us/products/primary-antibodies/cdc42-antibody-ab64533'>ab64533</a>.</p>" } } }

Sequence info

[{"sequence":"MASMTGGQQMGRGSHMQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P60953","tags":[{"tag":"T7","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

ab87713 is purified using conventional chromatography techniques.Endotoxin: < 1.0 EU per 1 microgram of protein (determined by LAL method).

General info

Function

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase (PubMed : 15642749). Regulates cell migration (PubMed : 17038317, PubMed : 22843693). In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections (PubMed : 14978216). Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. In podocytes, facilitates filopodia and podosomes formation upon DOCK11-activation (PubMed : 33523862). Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling (By similarity). Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups (PubMed : 26465210). Upon activation by PLEKHG4B, involved in actin cytoskeletal remodeling during epithelial cell-cell junction formation (PubMed : 33310911).

Sequence similarities

Belongs to the small GTPase superfamily. Rho family. CDC42 subfamily.

Post-translational modifications

(Microbial infection) AMPylation at Tyr-32 and Thr-35 are mediated by bacterial enzymes in case of infection by H.somnus and V.parahaemolyticus, respectively. AMPylation occurs in the effector region and leads to inactivation of the GTPase activity by preventing the interaction with downstream effectors, thereby inhibiting actin assembly in infected cells. It is unclear whether some human enzyme mediates AMPylation; FICD has such ability in vitro but additional experiments remain to be done to confirm results in vivo.. Phosphorylated by SRC in an EGF-dependent manner, this stimulates the binding of the Rho-GDP dissociation inhibitor RhoGDI.. (Microbial infection) Glycosylated at Tyr-32 by Photorhabdus asymbiotica toxin PAU_02230. Mono-O-GlcNAcylation by PAU_02230 inhibits downstream signaling by an impaired interaction with diverse regulator and effector proteins of CDC42 and leads to actin disassembly.. (Microbial infection) Glucosylated at Thr-35 by C.difficile toxins TcdA and TcdB in the colonic epithelium (PubMed:24905543, PubMed:7775453, PubMed:7777059). Monoglucosylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to actin cytoskeleton disruption and cell death, resulting in the loss of colonic epithelial barrier function (PubMed:7775453, PubMed:7777059).. (Microbial infection) Glycosylated (O-GlcNAcylated) at Thr-35 by C.novyi toxin TcdA (PubMed:8810274). O-GlcNAcylation completely prevents the recognition of the downstream effector, blocking the GTPases in their inactive form, leading to actin cytoskeleton disruption (PubMed:8810274).

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. Regulates the bipolar attachment of spindle microtubules to kinetochores before chromosome congression in metaphase (PubMed : 15642749). Regulates cell migration (PubMed : 17038317, PubMed : 22843693). In neurons, plays a role in the extension and maintenance of the formation of filopodia, thin and actin-rich surface projections (PubMed : 14978216). Required for DOCK10-mediated spine formation in Purkinje cells and hippocampal neurons. In podocytes, facilitates filopodia and podosomes formation upon DOCK11-activation (PubMed : 33523862). Upon activation by CaMKII, modulates dendritic spine structural plasticity by relaying CaMKII transient activation to synapse-specific, long-term signaling (By similarity). Also plays a role in phagocytosis through organization of the F-actin cytoskeleton associated with forming phagocytic cups (PubMed : 26465210). Upon activation by PLEKHG4B, involved in actin cytoskeletal remodeling during epithelial cell-cell junction formation (PubMed : 33310911).
See full target information Cell division control protein 42 homolog

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com