JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB271456

Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(2 Publications)

Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus) is a Human Full Length protein, in the 1 to 297 aa range, expressed in Baculovirus infected Sf9 cells, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CDC2, CDC28A, CDKN1, P34CDC2, CDK1, Cyclin-dependent kinase 1, Cell division control protein 2 homolog, Cell division protein kinase 1, p34 protein kinase, CCNB, CCNB1, G2/mitotic-specific cyclin-B1

2 Images
Functional Studies - Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus) (AB271456)
  • FuncS

Unknown

Functional Studies - Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus) (AB271456)

Functional analysis of ab271456.

Specific activity ≥200 pmol/min/μg.

Assay was done in a kinase buffer using Histone H1 (0.1 mg/ml) as a substrate with 20 μM ATP at 30°C for 45 min.

SDS-PAGE - Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus) (AB271456)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant human CDK1 + Cyclin B1 protein (Active) (GST tag N-Terminus) (AB271456)

SDS-PAGE analysis of ab271456.

Key facts

Purity

>90% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

Specific activity ≥200 pmol/min/μg.

Assay was done in a kinase buffer using Histone H1 (0.1 mg/ml) as a substrate with 20 μM ATP at 30°C for 45 min.

Accession

P06493

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

CDK1/CyclinB1 complex

Sequence info

[{"sequence":"MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM","proteinLength":"Full Length","predictedMolecularWeight":"60 kDa","actualMolecularWeight":null,"aminoAcidEnd":297,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P06493","tags":[{"tag":"GST","terminus":"N-Terminus"}]},{"sequence":"MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV","proteinLength":"Full Length","predictedMolecularWeight":"75 kDa","actualMolecularWeight":null,"aminoAcidEnd":433,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P14635","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition via association with multiple interphase cyclins (PubMed : 16407259, PubMed : 16933150, PubMed : 17459720, PubMed : 18356527, PubMed : 19509060, PubMed : 19917720, PubMed : 20171170, PubMed : 20935635, PubMed : 20937773, PubMed : 21063390, PubMed : 2188730, PubMed : 23355470, PubMed : 2344612, PubMed : 23601106, PubMed : 23602554, PubMed : 25556658, PubMed : 26829474, PubMed : 27814491, PubMed : 30139873, PubMed : 30704899, PubMed : 40440427). Phosphorylates PARVA/actopaxin, APC, AMPH, APC, ASB7, BARD1, Bcl-xL/BCL2L1, BRCA2, CALD1, CASP8, CDC7, CDC20, CDC25A, CDC25C, CC2D1A, CENPA, CSNK2 proteins/CKII, FZR1/CDH1, CDK7, CEBPB, CHAMP1, DMD/dystrophin, EEF1 proteins/EF-1, EZH2, KIF11/EG5, EGFR, FANCG, FOS, GFAP, GOLGA2/GM130, GRASP1, UBE2A/hHR6A, HIST1H1 proteins/histone H1, HMGA1, HIVEP3/KRC, UHRF1, KAT5, LMNA, LMNB, LBR, MKI67, LATS1, MAP1B, MAP4, MARCKS, MCM2, MCM4, MKLP1, MLST8, MYB, NEFH, NFIC, NPC/nuclear pore complex, PITPNM1/NIR2, NPM1, NCL, NUCKS1, NPM1/numatrin, ORC1, PRKAR2A, EEF1E1/p18, EIF3F/p47, p53/TP53, NONO/p54NRB, PAPOLA, PLEC/plectin, RB1, TPPP, UL40/R2, RAB4A, RAP1GAP, RBBP8/CtIP, RCC1, RPS6KB1/S6K1, KHDRBS1/SAM68, ESPL1, SKI, BIRC5/survivin, STIP1, TEX14, beta-tubulins, MAPT/TAU, NEDD1, VIM/vimentin, TK1, FOXO1, RUNX1/AML1, SAMHD1, SIRT2, CGAS and RUNX2 (PubMed : 16407259, PubMed : 16933150, PubMed : 17459720, PubMed : 18356527, PubMed : 19202191, PubMed : 19509060, PubMed : 19917720, PubMed : 20171170, PubMed : 20935635, PubMed : 20937773, PubMed : 21063390, PubMed : 2188730, PubMed : 22411829, PubMed : 23355470, PubMed : 2344612, PubMed : 23601106, PubMed : 23602554, PubMed : 25012651, PubMed : 25556658, PubMed : 26829474, PubMed : 27814491, PubMed : 30704899, PubMed : 32351706, PubMed : 34741373, PubMed : 40440427). CDK1/CDC2-cyclin-B controls pronuclear union in interphase fertilized eggs (PubMed : 18480403, PubMed : 20360007). Essential for early stages of embryonic development (PubMed : 18480403, PubMed : 20360007). During G2 and early mitosis, CDC25A/B/C-mediated dephosphorylation activates CDK1/cyclin complexes which phosphorylate several substrates that trigger at least centrosome separation, Golgi dynamics, nuclear envelope breakdown and chromosome condensation (PubMed : 18480403, PubMed : 20360007, PubMed : 2188730, PubMed : 2344612, PubMed : 30139873). Once chromosomes are condensed and aligned at the metaphase plate, CDK1 activity is switched off by WEE1- and PKMYT1-mediated phosphorylation to allow sister chromatid separation, chromosome decondensation, reformation of the nuclear envelope and cytokinesis (PubMed : 18480403, PubMed : 20360007). Phosphorylates KRT5 during prometaphase and metaphase (By similarity). Inactivated by PKR/EIF2AK2- and WEE1-mediated phosphorylation upon DNA damage to stop cell cycle and genome replication at the G2 checkpoint thus facilitating DNA repair (PubMed : 20360007). Reactivated after successful DNA repair through WIP1-dependent signaling leading to CDC25A/B/C-mediated dephosphorylation and restoring cell cycle progression (PubMed : 20395957). Catalyzes lamin (LMNA, LMNB1 and LMNB2) phosphorylation at the onset of mitosis, promoting nuclear envelope breakdown (PubMed : 2188730, PubMed : 2344612, PubMed : 37788673). In proliferating cells, CDK1-mediated FOXO1 phosphorylation at the G2-M phase represses FOXO1 interaction with 14-3-3 proteins and thereby promotes FOXO1 nuclear accumulation and transcription factor activity, leading to cell death of postmitotic neurons (PubMed : 18356527). The phosphorylation of beta-tubulins regulates microtubule dynamics during mitosis (PubMed : 16371510). NEDD1 phosphorylation promotes PLK1-mediated NEDD1 phosphorylation and subsequent targeting of the gamma-tubulin ring complex (gTuRC) to the centrosome, an important step for spindle formation (PubMed : 19509060). In addition, CC2D1A phosphorylation regulates CC2D1A spindle pole localization and association with SCC1/RAD21 and centriole cohesion during mitosis (PubMed : 20171170). The phosphorylation of Bcl-xL/BCL2L1 after prolongated G2 arrest upon DNA damage triggers apoptosis (PubMed : 19917720). In contrast, CASP8 phosphorylation during mitosis prevents its activation by proteolysis and subsequent apoptosis (PubMed : 20937773). This phosphorylation occurs in cancer cell lines, as well as in primary breast tissues and lymphocytes (PubMed : 20937773). EZH2 phosphorylation promotes H3K27me3 maintenance and epigenetic gene silencing (PubMed : 20935635). CALD1 phosphorylation promotes Schwann cell migration during peripheral nerve regeneration (By similarity). CDK1-cyclin-B complex phosphorylates NCKAP5L and mediates its dissociation from centrosomes during mitosis (PubMed : 26549230). Regulates the amplitude of the cyclic expression of the core clock gene BMAL1 by phosphorylating its transcriptional repressor NR1D1, and this phosphorylation is necessary for SCF(FBXW7)-mediated ubiquitination and proteasomal degradation of NR1D1 (PubMed : 27238018). Phosphorylates EML3 at 'Thr-881' which is essential for its interaction with HAUS augmin-like complex and TUBG1 (PubMed : 30723163). Phosphorylates CGAS during mitosis, leading to its inhibition, thereby preventing CGAS activation by self DNA during mitosis (PubMed : 32351706). Phosphorylates SKA3 on multiple sites during mitosis which promotes SKA3 binding to the NDC80 complex and anchoring of the SKA complex to kinetochores, to enable stable attachment of mitotic spindle microtubules to kinetochores (PubMed : 28479321, PubMed : 31804178, PubMed : 32491969).. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry.

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Post-translational modifications

Phosphorylation at Thr-161 by CAK/CDK7 activates kinase activity (PubMed:20360007). Phosphorylation at Thr-14 and Tyr-15 by PKMYT1 prevents nuclear translocation (PubMed:7569953). Phosphorylation at Tyr-15 by WEE1 and WEE2 inhibits the protein kinase activity and acts as a negative regulator of entry into mitosis (G2 to M transition) (PubMed:20360007). Phosphorylation by PKMYT1 and WEE1 takes place during mitosis to keep CDK1-cyclin-B complexes inactive until the end of G2 (PubMed:20360007, PubMed:7569953). By the end of G2, PKMYT1 and WEE1 are inactivated, but CDC25A and CDC25B are activated (PubMed:20360007). Dephosphorylation by active CDC25A and CDC25B at Thr-14 and Tyr-15, leads to CDK1 activation at the G2-M transition (PubMed:20360007). Phosphorylation at Tyr-15 by WEE2 during oogenesis is required to maintain meiotic arrest in oocytes during the germinal vesicle (GV) stage, a long period of quiescence at dictyate prophase I, leading to prevent meiotic reentry (PubMed:29606300). Phosphorylation by WEE2 is also required for metaphase II exit during egg activation to ensure exit from meiosis in oocytes and promote pronuclear formation (PubMed:29606300). Phosphorylated at Tyr-4 by PKR/EIF2AK2 upon genotoxic stress (PubMed:20395957). This phosphorylation triggers CDK1 polyubiquitination and subsequent proteolysis, thus leading to G2 arrest (PubMed:20395957). In response to UV irradiation, phosphorylation at Tyr-15 by PRKCD activates the G2/M DNA damage checkpoint (PubMed:19917613).. Polyubiquitinated upon genotoxic stress.

Product protocols

Target data

Plays a key role in the control of the eukaryotic cell cycle by modulating the centrosome cycle as well as mitotic onset; promotes G2-M transition via association with multiple interphase cyclins (PubMed : 16407259, PubMed : 16933150, PubMed : 17459720, PubMed : 18356527, PubMed : 19509060, PubMed : 19917720, PubMed : 20171170, PubMed : 20935635, PubMed : 20937773, PubMed : 21063390, PubMed : 2188730, PubMed : 23355470, PubMed : 2344612, PubMed : 23601106, PubMed : 23602554, PubMed : 25556658, PubMed : 26829474, PubMed : 27814491, PubMed : 30139873, PubMed : 30704899, PubMed : 40440427). Phosphorylates PARVA/actopaxin, APC, AMPH, APC, ASB7, BARD1, Bcl-xL/BCL2L1, BRCA2, CALD1, CASP8, CDC7, CDC20, CDC25A, CDC25C, CC2D1A, CENPA, CSNK2 proteins/CKII, FZR1/CDH1, CDK7, CEBPB, CHAMP1, DMD/dystrophin, EEF1 proteins/EF-1, EZH2, KIF11/EG5, EGFR, FANCG, FOS, GFAP, GOLGA2/GM130, GRASP1, UBE2A/hHR6A, HIST1H1 proteins/histone H1, HMGA1, HIVEP3/KRC, UHRF1, KAT5, LMNA, LMNB, LBR, MKI67, LATS1, MAP1B, MAP4, MARCKS, MCM2, MCM4, MKLP1, MLST8, MYB, NEFH, NFIC, NPC/nuclear pore complex, PITPNM1/NIR2, NPM1, NCL, NUCKS1, NPM1/numatrin, ORC1, PRKAR2A, EEF1E1/p18, EIF3F/p47, p53/TP53, NONO/p54NRB, PAPOLA, PLEC/plectin, RB1, TPPP, UL40/R2, RAB4A, RAP1GAP, RBBP8/CtIP, RCC1, RPS6KB1/S6K1, KHDRBS1/SAM68, ESPL1, SKI, BIRC5/survivin, STIP1, TEX14, beta-tubulins, MAPT/TAU, NEDD1, VIM/vimentin, TK1, FOXO1, RUNX1/AML1, SAMHD1, SIRT2, CGAS and RUNX2 (PubMed : 16407259, PubMed : 16933150, PubMed : 17459720, PubMed : 18356527, PubMed : 19202191, PubMed : 19509060, PubMed : 19917720, PubMed : 20171170, PubMed : 20935635, PubMed : 20937773, PubMed : 21063390, PubMed : 2188730, PubMed : 22411829, PubMed : 23355470, PubMed : 2344612, PubMed : 23601106, PubMed : 23602554, PubMed : 25012651, PubMed : 25556658, PubMed : 26829474, PubMed : 27814491, PubMed : 30704899, PubMed : 32351706, PubMed : 34741373, PubMed : 40440427). CDK1/CDC2-cyclin-B controls pronuclear union in interphase fertilized eggs (PubMed : 18480403, PubMed : 20360007). Essential for early stages of embryonic development (PubMed : 18480403, PubMed : 20360007). During G2 and early mitosis, CDC25A/B/C-mediated dephosphorylation activates CDK1/cyclin complexes which phosphorylate several substrates that trigger at least centrosome separation, Golgi dynamics, nuclear envelope breakdown and chromosome condensation (PubMed : 18480403, PubMed : 20360007, PubMed : 2188730, PubMed : 2344612, PubMed : 30139873). Once chromosomes are condensed and aligned at the metaphase plate, CDK1 activity is switched off by WEE1- and PKMYT1-mediated phosphorylation to allow sister chromatid separation, chromosome decondensation, reformation of the nuclear envelope and cytokinesis (PubMed : 18480403, PubMed : 20360007). Phosphorylates KRT5 during prometaphase and metaphase (By similarity). Inactivated by PKR/EIF2AK2- and WEE1-mediated phosphorylation upon DNA damage to stop cell cycle and genome replication at the G2 checkpoint thus facilitating DNA repair (PubMed : 20360007). Reactivated after successful DNA repair through WIP1-dependent signaling leading to CDC25A/B/C-mediated dephosphorylation and restoring cell cycle progression (PubMed : 20395957). Catalyzes lamin (LMNA, LMNB1 and LMNB2) phosphorylation at the onset of mitosis, promoting nuclear envelope breakdown (PubMed : 2188730, PubMed : 2344612, PubMed : 37788673). In proliferating cells, CDK1-mediated FOXO1 phosphorylation at the G2-M phase represses FOXO1 interaction with 14-3-3 proteins and thereby promotes FOXO1 nuclear accumulation and transcription factor activity, leading to cell death of postmitotic neurons (PubMed : 18356527). The phosphorylation of beta-tubulins regulates microtubule dynamics during mitosis (PubMed : 16371510). NEDD1 phosphorylation promotes PLK1-mediated NEDD1 phosphorylation and subsequent targeting of the gamma-tubulin ring complex (gTuRC) to the centrosome, an important step for spindle formation (PubMed : 19509060). In addition, CC2D1A phosphorylation regulates CC2D1A spindle pole localization and association with SCC1/RAD21 and centriole cohesion during mitosis (PubMed : 20171170). The phosphorylation of Bcl-xL/BCL2L1 after prolongated G2 arrest upon DNA damage triggers apoptosis (PubMed : 19917720). In contrast, CASP8 phosphorylation during mitosis prevents its activation by proteolysis and subsequent apoptosis (PubMed : 20937773). This phosphorylation occurs in cancer cell lines, as well as in primary breast tissues and lymphocytes (PubMed : 20937773). EZH2 phosphorylation promotes H3K27me3 maintenance and epigenetic gene silencing (PubMed : 20935635). CALD1 phosphorylation promotes Schwann cell migration during peripheral nerve regeneration (By similarity). CDK1-cyclin-B complex phosphorylates NCKAP5L and mediates its dissociation from centrosomes during mitosis (PubMed : 26549230). Regulates the amplitude of the cyclic expression of the core clock gene BMAL1 by phosphorylating its transcriptional repressor NR1D1, and this phosphorylation is necessary for SCF(FBXW7)-mediated ubiquitination and proteasomal degradation of NR1D1 (PubMed : 27238018). Phosphorylates EML3 at 'Thr-881' which is essential for its interaction with HAUS augmin-like complex and TUBG1 (PubMed : 30723163). Phosphorylates CGAS during mitosis, leading to its inhibition, thereby preventing CGAS activation by self DNA during mitosis (PubMed : 32351706). Phosphorylates SKA3 on multiple sites during mitosis which promotes SKA3 binding to the NDC80 complex and anchoring of the SKA complex to kinetochores, to enable stable attachment of mitotic spindle microtubules to kinetochores (PubMed : 28479321, PubMed : 31804178, PubMed : 32491969).. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry.
See full target information CDK1

Additional targets

CCNB1

Publications (2)

Recent publications for all applications. Explore the full list and refine your search

The Journal of biological chemistry 301:108033 PubMed39615679

2024

Phosphorylation of Lamin A/C regulates the structural integrity of the nuclear envelope.

Applications

Unspecified application

Species

Unspecified reactive species

Shuaiyu Liu,Fangyuan Xiong,Zhen Dou,Lingluo Chu,Yihan Yao,Ming Wang,Xuebiao Yao,Xing Liu,Zhikai Wang

Cell reports 43:114431 PubMed38968071

2024

Elevating PLK1 overcomes BETi resistance in prostate cancer via triggering BRD4 phosphorylation-dependent degradation in mitosis.

Applications

Unspecified application

Species

Unspecified reactive species

Yanquan Zhang,Ka-Wing Fong,Fengyi Mao,Ruixin Wang,Derek B Allison,Dana Napier,Daheng He,Jinpeng Liu,Yeqing Zhang,Jing Chen,Yifan Kong,Chaohao Li,Guangbing Li,Jinghui Liu,Zhiguo Li,Haining Zhu,Chi Wang,Xiaoqi Liu
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com