JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB201715

Recombinant Human CDK5RAP3 protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CDK5RAP3 protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 506 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

IC53, LZAP, MSTP016, OK/SW-cl.114, PP1553, CDK5RAP3, CDK5 regulatory subunit-associated protein 3, CDK5 activator-binding protein C53, LXXLL/leucine-zipper-containing ARF-binding protein, Protein HSF-27

1 Images
SDS-PAGE - Recombinant Human CDK5RAP3 protein (His tag N-Terminus) (AB201715)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CDK5RAP3 protein (His tag N-Terminus) (AB201715)

15% SDS-PAGE analysis of ab201715 (3μg).

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q96JB5

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.4 Constituents: PBS, 20% Glycerol (glycerin, glycerine), 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL","proteinLength":"Full Length","predictedMolecularWeight":"59 kDa","actualMolecularWeight":null,"aminoAcidEnd":506,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q96JB5","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Specifications

Form

Liquid

Additional notes

ab201715 was purified using conventional chromatography techniques.

General info

Function

Substrate adapter of E3 ligase complexes mediating ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to substrate proteins, and which is involved in various processes, such as ribosome recycling and reticulophagy (also called ER-phagy) (PubMed : 23152784, PubMed : 30635284, PubMed : 32851973, PubMed : 36121123, PubMed : 36543799, PubMed : 37595036, PubMed : 38383785, PubMed : 38383789). As part of the UREL complex, plays a key role in ribosome recycling by promoting mono-ufmylation of RPL26/uL24 subunit of the 60S ribosome (PubMed : 38383785, PubMed : 38383789). Ufmylation of RPL26/uL24 occurs on free 60S ribosomes following ribosome dissociation : it weakens the junction between post-termination 60S subunits and SEC61 translocons, promoting release and recycling of the large ribosomal subunit from the endoplasmic reticulum membrane (PubMed : 38383785, PubMed : 38383789). Ufmylation of RPL26/uL24 and subsequent 60S ribosome recycling either take place after normal termination of translation or after ribosome stalling during cotranslational translocation at the endoplasmic reticulum (PubMed : 32851973, PubMed : 37595036, PubMed : 38383785, PubMed : 38383789). Within the UREL complex, CDK5RAP3 acts as a substrate adapter that constrains UFL1 ligase activity to mono-ufmylate RPL26/uL24 at 'Lys-134' (PubMed : 36121123, PubMed : 38383785, PubMed : 38383789). The UREL complex is also involved in reticulophagy in response to endoplasmic reticulum stress by promoting ufmylation of proteins such as CYB5R3, thereby promoting lysosomal degradation of ufmylated proteins (PubMed : 36543799). Also acts as a regulator of transcription : negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation (PubMed : 17785205, PubMed : 20228063). Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint (PubMed : 15790566, PubMed : 19223857). Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation (PubMed : 16173922). May also play a role in the rupture of the nuclear envelope during apoptosis (PubMed : 23478299). May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1 (PubMed : 21283629). Required for liver development (By similarity).. (Microbial infection) May be negatively regulated by hepatitis B virus large envelope protein mutant pre-s2 to promote mitotic entry.

Sequence similarities

Belongs to the CDK5RAP3 family.

Post-translational modifications

May be phosphorylated by CDK5.. Ubiquitinated. Probably triggers proteasomal degradation and is negatively regulated by UFL1.. May be ufmylated.. Cleaved by caspases early during apoptosis, the resulting peptides may play a role in rupture of the nuclear envelope.

Subcellular localisation

Nucleus

Product protocols

Target data

Substrate adapter of E3 ligase complexes mediating ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to substrate proteins, and which is involved in various processes, such as ribosome recycling and reticulophagy (also called ER-phagy) (PubMed : 23152784, PubMed : 30635284, PubMed : 32851973, PubMed : 36121123, PubMed : 36543799, PubMed : 37595036, PubMed : 38383785, PubMed : 38383789). As part of the UREL complex, plays a key role in ribosome recycling by promoting mono-ufmylation of RPL26/uL24 subunit of the 60S ribosome (PubMed : 38383785, PubMed : 38383789). Ufmylation of RPL26/uL24 occurs on free 60S ribosomes following ribosome dissociation : it weakens the junction between post-termination 60S subunits and SEC61 translocons, promoting release and recycling of the large ribosomal subunit from the endoplasmic reticulum membrane (PubMed : 38383785, PubMed : 38383789). Ufmylation of RPL26/uL24 and subsequent 60S ribosome recycling either take place after normal termination of translation or after ribosome stalling during cotranslational translocation at the endoplasmic reticulum (PubMed : 32851973, PubMed : 37595036, PubMed : 38383785, PubMed : 38383789). Within the UREL complex, CDK5RAP3 acts as a substrate adapter that constrains UFL1 ligase activity to mono-ufmylate RPL26/uL24 at 'Lys-134' (PubMed : 36121123, PubMed : 38383785, PubMed : 38383789). The UREL complex is also involved in reticulophagy in response to endoplasmic reticulum stress by promoting ufmylation of proteins such as CYB5R3, thereby promoting lysosomal degradation of ufmylated proteins (PubMed : 36543799). Also acts as a regulator of transcription : negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation (PubMed : 17785205, PubMed : 20228063). Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint (PubMed : 15790566, PubMed : 19223857). Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation (PubMed : 16173922). May also play a role in the rupture of the nuclear envelope during apoptosis (PubMed : 23478299). May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1 (PubMed : 21283629). Required for liver development (By similarity).. (Microbial infection) May be negatively regulated by hepatitis B virus large envelope protein mutant pre-s2 to promote mitotic entry.
See full target information CDK5RAP3

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com