JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB268398

Recombinant human Cdk7 + Cyclin H/p34 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Cdk7 + Cyclin H/p34 protein (Active) is a Human Full Length protein, in the 1 to 323 aa range, expressed in Baculovirus infected Sf9 cells, with >70%, suitable for SDS-PAGE, FuncS.

View Alternative Names

CAK, CAK1, CDKN7, MO15, STK1, CDK7, Cyclin-dependent kinase 7, 39 kDa protein kinase, CDK-activating kinase 1, Cell division protein kinase 7, Serine/threonine-protein kinase 1, TFIIH basal transcription factor complex kinase subunit, p39 Mo15

2 Images
Functional Studies - Recombinant human Cdk7 + Cyclin H/p34 protein (Active) (AB268398)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Cdk7 + Cyclin H/p34 protein (Active) (AB268398)

The specific activity of ab268398 was 3.0 nmol/min/min in a kinase assay using myelin basic protein as substrate.

SDS-PAGE - Recombinant human Cdk7 + Cyclin H/p34 protein (Active) (AB268398)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human Cdk7 + Cyclin H/p34 protein (Active) (AB268398)

SDS-PAGE analysis of ab268398.

Key facts

Purity

>70% SDS-PAGE

Expression system

Baculovirus infected Sf9 cells

Tags

Tag free

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

The specific activity of ab268398 was 3.0 nmol/min/min in a kinase assay using myelin basic protein as substrate.

Accession

P50613

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 25% Glycerol (glycerin, glycerine), 1.74% Sodium chloride, 0.82% Sodium phosphate, 0.004% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.002% PMSF

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Proteins co-expressed.

Sequence info

[{"sequence":"MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":323,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Baculovirus infected Sf9 cells","accessionNumber":"P51946","tags":[{"tag":"His","terminus":"N-Terminus"}]},{"sequence":"","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":0,"aminoAcidStart":0,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P50613","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Cdk7 also known as Cyclin-dependent kinase 7 forms a complex with Cyclin H sometimes referred to as p34. Mechanically Cdk7 functions as a kinase an enzyme that adds phosphate groups to other proteins which is an important regulatory activity in many cellular processes. As a part of the CDK-activating kinase (CAK) complex Cdk7 has a molecular mass of around 40 kDa. It resides in various cellular compartments predominantly in the nucleus where its regulatory activity largely occurs.
Biological function summary

The Cdk7-Cyclin H/p34 complex plays a significant role in cell cycle regulation acting at important checkpoints for transitioning between different phases of the cell cycle. It participates in the phosphorylation of other cyclin-dependent kinases therefore activating them and promoting cell cycle progression. The Cdk7-Cyclin H complex is an essential factor of the transcription process as it forms part of the transcription factor IIH (TFIIH) a multiprotein complex involved in transcription initiation and DNA repair.

Pathways

Cdk7 is an important regulator within the cell cycle and transcription regulation pathways. Notably it acts in close coordination with the p53 protein during DNA damage response ensuring genomic integrity through controlled cell cycle arrest. Additionally Cdk7 associates with the MAPK pathway linking signal transduction with cell cycle control which further exemplifies its broad regulatory impact within cells.

Dysregulation of the Cdk7-Cyclin H/p34 complex is associated with cancer particularly in its ability to alter cell cycle control and transcription regulation which may lead to unchecked cell proliferation. Studies have shown that cancer cells often exhibit elevated levels of Cdk7 linking its activity to oncogenic transformation. Moreover variations in Cdk7 activity are implicated in neurodegenerative diseases particularly Alzheimer's disease where altered transcriptional regulation contributes to disease pathogenesis. The p53 protein which interacts with Cdk7 often shows mutations in cancer highlighting their interconnected roles in these conditions.

Specifications

Form

Liquid

Additional notes

Affinity purified.

General info

Function

Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts (PubMed : 9852112). Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Post-translational modifications

Phosphorylation of Ser-164 during mitosis inactivates the enzyme. Phosphorylation of Thr-170 is required for activity. Phosphorylated at Ser-164 and Thr-170 by CDK2.

Subcellular localisation

Nucleus

Product protocols

Target data

Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts (PubMed : 9852112). Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition.
See full target information CDK7

Additional targets

Cyclin-H

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com