Recombinant human Cdk9 + Cyclin K protein (Active)
Be the first to review this product! Submit a review
|
(0 Publication)
Recombinant human Cdk9 + Cyclin K protein (Active) is a Human Full Length protein, in the 1 to 372 aa range, expressed in Baculovirus infected Sf9 cells, with >85%, suitable for SDS-PAGE, FuncS.
View Alternative Names
CDC2L4, TAK, CDK9, Cyclin-dependent kinase 9, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Tat-associated kinase complex catalytic subunit
- FuncS
Supplier Data
Functional Studies - Recombinant human Cdk9 + Cyclin K protein (Active) (AB268401)
The specific activity of ab268401 was 3.1 nmol/min/min in a peptide kinase assay using PDKtide synthetic peptide substrate (KTFCGTPEYLAPEVRREP-RILSEEEQEMFRDFDYIADWC) as substrate.
- SDS-PAGE
Unknown
SDS-PAGE - Recombinant human Cdk9 + Cyclin K protein (Active) (AB268401)
SDS-PAGE analysis of ab268401
Reactivity data
Sequence info
Properties and storage information
Shipped at conditions
Appropriate short-term storage conditions
Appropriate long-term storage conditions
Aliquoting information
Storage information
Supplementary information
This supplementary information is collated from multiple sources and compiled automatically.
Biological function summary
Cdk9 and Cyclin K belong to the positive transcription elongation factor b (P-TEFb) complex. This complex plays a significant role in controlling the elongation phase of transcription by RNA polymerase II. P-TEFb phosphorylates the carboxy-terminal domain (CTD) of RNA polymerase II which is necessary for efficient transcriptional elongation. Their activity is important for transcriptional regulation and hence for proper cell cycle progression and maintenance of gene expression profiles.
Pathways
Cdk9 and Cyclin K are integral to transcription-related pathways. They participate primarily in the regulation of gene expression by influencing the transcription of various genes necessary for cell growth and differentiation. The P-TEFb complex which includes other proteins such as Cyclin T is central in the transcriptional pathway through modulation of RNA polymerase II activity. This control impacts the overall pattern of protein expression in response to cellular signals.
Specifications
Form
Liquid
Additional notes
Affinity purified.
General info
Function
Protein kinase involved in the regulation of transcription (PubMed : 10574912, PubMed : 10757782, PubMed : 11145967, PubMed : 11575923, PubMed : 11809800, PubMed : 11884399, PubMed : 14701750, PubMed : 16109376, PubMed : 16109377, PubMed : 20930849, PubMed : 28426094, PubMed : 29335245). Member of the cyclin-dependent kinase pair (CDK9/cyclin-T) complex, also called positive transcription elongation factor b (P-TEFb), which facilitates the transition from abortive to productive elongation by phosphorylating the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAP II) POLR2A, SUPT5H and RDBP (PubMed : 10574912, PubMed : 10757782, PubMed : 11145967, PubMed : 11575923, PubMed : 11809800, PubMed : 11884399, PubMed : 14701750, PubMed : 16109376, PubMed : 16109377, PubMed : 20930849, PubMed : 28426094, PubMed : 30134174). This complex is inactive when in the 7SK snRNP complex form (PubMed : 10574912, PubMed : 10757782, PubMed : 11145967, PubMed : 11575923, PubMed : 11809800, PubMed : 11884399, PubMed : 14701750, PubMed : 16109376, PubMed : 16109377, PubMed : 20930849, PubMed : 28426094). Phosphorylates EP300, MYOD1, RPB1/POLR2A and AR and the negative elongation factors DSIF and NELFE (PubMed : 10912001, PubMed : 11112772, PubMed : 12037670, PubMed : 20081228, PubMed : 20980437, PubMed : 21127351, PubMed : 9857195). Regulates cytokine inducible transcription networks by facilitating promoter recognition of target transcription factors (e.g. TNF-inducible RELA/p65 activation and IL-6-inducible STAT3 signaling) (PubMed : 17956865, PubMed : 18362169). Promotes RNA synthesis in genetic programs for cell growth, differentiation and viral pathogenesis (PubMed : 10393184, PubMed : 11112772). P-TEFb is also involved in cotranscriptional histone modification, mRNA processing and mRNA export (PubMed : 15564463, PubMed : 19575011, PubMed : 19844166). Modulates a complex network of chromatin modifications including histone H2B monoubiquitination (H2Bub1), H3 lysine 4 trimethylation (H3K4me3) and H3K36me3; integrates phosphorylation during transcription with chromatin modifications to control co-transcriptional histone mRNA processing (PubMed : 15564463, PubMed : 19575011, PubMed : 19844166). The CDK9/cyclin-K complex has also a kinase activity towards CTD of RNAP II and can substitute for CDK9/cyclin-T P-TEFb in vitro (PubMed : 21127351). Replication stress response protein; the CDK9/cyclin-K complex is required for genome integrity maintenance, by promoting cell cycle recovery from replication arrest and limiting single-stranded DNA amount in response to replication stress, thus reducing the breakdown of stalled replication forks and avoiding DNA damage (PubMed : 20493174). In addition, probable function in DNA repair of isoform 2 via interaction with KU70/XRCC6 (PubMed : 20493174). Promotes cardiac myocyte enlargement (PubMed : 20081228). RPB1/POLR2A phosphorylation on 'Ser-2' in CTD activates transcription (PubMed : 21127351). AR phosphorylation modulates AR transcription factor promoter selectivity and cell growth. DSIF and NELF phosphorylation promotes transcription by inhibiting their negative effect (PubMed : 10912001, PubMed : 11112772, PubMed : 9857195). The phosphorylation of MYOD1 enhances its transcriptional activity and thus promotes muscle differentiation (PubMed : 12037670). Catalyzes phosphorylation of KAT5, promoting KAT5 recruitment to chromatin and histone acetyltransferase activity (PubMed : 29335245).
Sequence similarities
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Post-translational modifications
Autophosphorylation at Thr-186, Ser-347, Thr-350, Ser-353, Thr-354 and Ser-357 triggers kinase activity by promoting cyclin and substrate binding (e.g. HIV TAT) upon conformational changes. Thr-186 phosphorylation requires the calcium Ca(2+) signaling pathway, including CaMK1D and calmodulin. This inhibition is relieved by Thr-29 dephosphorylation. However, phosphorylation at Thr-29 is inhibitory within the HIV transcription initiation complex. Phosphorylation at Ser-175 inhibits kinase activity. Can be phosphorylated on either Thr-362 or Thr-363 but not on both simultaneously (PubMed:18566585).. Dephosphorylation of Thr-186 by PPM1A and PPM1B blocks CDK9 activity and may lead to CDK9 proteasomal degradation. However, PPP1CA-mediated Thr-186 dephosphorylation is required to release P-TEFb from its inactive P-TEFb/7SK snRNP complex. Dephosphorylation of C-terminus Thr and Ser residues by protein phosphatase-1 (PP1) triggers CDK9 activity, contributing to the activation of HIV-1 transcription.. N6-acetylation of Lys-44 promotes kinase activity, whereas acetylation of both Lys-44 and Lys-48 mediated by PCAF/KAT2B and GCN5/KAT2A reduces kinase activity (PubMed:17452463, PubMed:18250157). The acetylated form associates with PML bodies in the nuclear matrix and with the transcriptionally silent HIV-1 genome; deacetylated upon transcription stimulation (PubMed:17452463, PubMed:18250157). Deacetylated by SIRT7, promoting the kinase activity and subsequent 'Ser-2' phosphorylation of the C-terminal domain (CTD) of RNA polymerase II (PubMed:28426094).. Polyubiquitinated and thus activated by UBR5. This ubiquitination is promoted by TFIIS/TCEA1 and favors 'Ser-2' phosphorylation of RPB1/POLR2A CTD.
Subcellular localisation
Nucleus
Target data
Additional targets
Complementary Products
Product promise
Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.
For licensing inquiries, please contact partnerships@abcam.com