JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB126912

Recombinant Human CEAP protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CEAP protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 142 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

BLOS2, CEAP, BLOC1S2, Biogenesis of lysosome-related organelles complex 1 subunit 2, BLOC-1 subunit 2, Centrosome-associated protein

1 Images
SDS-PAGE - Recombinant Human CEAP protein (His tag N-Terminus) (AB126912)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CEAP protein (His tag N-Terminus) (AB126912)

15% SDS-PAGE showing ab126912 (3 µg). Please note : Molecular weight on SDS-PAGE will appear higher.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

Mass Spec, SDS-PAGE

applications

Biologically active

No

Accession

Q6QNY1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.32% Tris HCl, 0.29% Sodium chloride, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as BLOC1S2

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR","proteinLength":"Full Length","predictedMolecularWeight":"18.5 kDa","actualMolecularWeight":null,"aminoAcidEnd":142,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q6QNY1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The biological target known as CEAP also referred to as C-E-A-P bloc1s2 is a protein complex. The precise mass of CEAP is not well documented but it plays an important role in various cellular functions. CEAP is expressed in many tissues throughout the human body indicating its diverse and significant role in cellular biology. Researchers are paying attention to its presence and functions due to its potential implications in various biological processes.
Biological function summary

CEAP participates in cellular organization and transport mechanisms. It is a part of the larger bloc1s2 complex which suggests its involvement in the structural support within cells. The complex maintains cellular integrity which assists in the proper functioning of cellular processes. CEAP's role in regulating these activities makes it an important component of cellular machinery ensuring that cellular events occur accurately and efficiently.

Pathways

CEAP is involved in the endocytic pathway and vesicular transport processes. The protein supports the trafficking of molecules across cell membranes working alongside other proteins such as clathrin and adaptor complexes. This involvement facilitates important cellular activities and maintains homeostasis by regulating the internal and external transport of critical substances. Additionally CEAP's function in endocytosis places it within networks essential for maintaining cellular communication and nutrient uptake.

CEAP has shown associations with neurodegenerative diseases and certain cancers. Altered functionality or expression levels of CEAP can impact the endocytic pathway affecting cellular homeostasis and potentially leading to disease conditions. For example disruptions in CEAP activity have been observed in relation to Alzheimer's disease where abnormal protein aggregation occurs. Furthermore connections to oncogenic pathways highlight the significance of CEAP in tumor biology showing interactions with tumor suppressor proteins like p53. Understanding CEAP's roles could provide insights for therapeutic targets in these conditions.

Specifications

Form

Liquid

Additional notes

ab126912 is purified by conventional chromatography techniques to > 85% by SDS - PAGE.

General info

Function

Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes (PubMed : 15102850, PubMed : 17182842). In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (By similarity). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (PubMed : 25898167). May play a role in cell proliferation (PubMed : 15381421).

Sequence similarities

Belongs to the BLOC1S2 family.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes (PubMed : 15102850, PubMed : 17182842). In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension (By similarity). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (PubMed : 25898167). May play a role in cell proliferation (PubMed : 15381421).
See full target information BLOC1S2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com