JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB51301

Recombinant Human CEBP Alpha/CEBPA protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CEBP Alpha/CEBPA protein (His tag N-Terminus) is a Human Fragment protein, in the 270 to 358 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

CEBP, CEBPA, CCAAT/enhancer-binding protein alpha, C/EBP alpha

1 Images
SDS-PAGE - Recombinant Human CEBP Alpha/CEBPA protein (His tag N-Terminus) (AB51301)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CEBP Alpha/CEBPA protein (His tag N-Terminus) (AB51301)

3ug by SDS-PAGE under reducing conditions and visualized by coomassie blue stain.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P49715

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 7.5 Constituents: 0.58% Sodium chloride, 0.316% Tris HCl, 0.039% 2-Mercaptoethanol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

This product was previously labelled as CEBP Alpha

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":358,"aminoAcidStart":270,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P49715","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CEBP Alpha also known as CEBPA is a transcription factor belonging to the CCAAT/enhancer-binding protein family. It is composed of a molecular mass approximately between 42 to 45 kDa and is characterized by the leucine zipper motif which contributes to its function in dimerization and DNA binding. CEBP Alpha is expressed in various tissues with notable expression in the liver adipose tissue and hematopoietic cells where it plays a significant role in regulating gene expression related to growth arrest and differentiation.
Biological function summary

CEBP Alpha regulates important cellular processes by acting as a transcriptional regulator. It participates in the control of cellular differentiation proliferation and metabolism. CEBP Alpha forms homo- or heterodimers with other proteins of the CEBP family to exert its functions. It induces expression of genes involved in differentiation of myeloid progenitors into granulocytes and macrophages. The protein also promotes adipogenesis by activating genes responsible for the development and function of adipocytes.

Pathways

CEBP Alpha participates actively in signaling pathways that involve cell cycle control and hematopoiesis. In the hematopoietic pathway CEBP Alpha influences the differentiation of progenitor cells into mature blood cells. Additionally it interacts with other proteins such as PU.1 an important regulator in the myeloid lineage and through the MAPK pathway influences growth arrest and differentiation responses. These interactions highlight its essential role in maintaining the balance between cell proliferation and differentiation.

Alterations in the function or expression of CEBP Alpha have consequential links to acute myeloid leukemia (AML) and obesity. Mutations or disruptions in the CEBP Alpha gene can lead to impaired granulocyte differentiation contributing to the pathogenesis of AML. Additionally CEBP Alpha through its role in adipogenesis is associated with metabolic disorders such as obesity. The protein's interaction with other transcription factors like FLT3 and GATA-2 in the context of these diseases highlights its critical involvement in maintaining normal physiological functions.

Specifications

Form

Liquid

Additional notes

ab51301 was purified by ion-exchange chromatography and FPLC gel-filtration chromatography.

General info

Function

Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting as an activator on distinct target genes (PubMed : 11242107). During early embryogenesis, plays essential and redundant functions with CEBPB. Essential for the transition from common myeloid progenitors (CMP) to granulocyte/monocyte progenitors (GMP). Critical for the proper development of the liver and the lung (By similarity). Necessary for terminal adipocyte differentiation, is required for postnatal maintenance of systemic energy homeostasis and lipid storage (By similarity). To regulate these different processes at the proper moment and tissue, interplays with other transcription factors and modulators. Down-regulates the expression of genes that maintain cells in an undifferentiated and proliferative state through E2F1 repression, which is critical for its ability to induce adipocyte and granulocyte terminal differentiation. Reciprocally E2F1 blocks adipocyte differentiation by binding to specific promoters and repressing CEBPA binding to its target gene promoters. Proliferation arrest also depends on a functional binding to SWI/SNF complex (PubMed : 14660596). In liver, regulates gluconeogenesis and lipogenesis through different mechanisms. To regulate gluconeogenesis, functionally cooperates with FOXO1 binding to IRE-controlled promoters and regulating the expression of target genes such as PCK1 or G6PC1. To modulate lipogenesis, interacts and transcriptionally synergizes with SREBF1 in promoter activation of specific lipogenic target genes such as ACAS2. In adipose tissue, seems to act as FOXO1 coactivator accessing to ADIPOQ promoter through FOXO1 binding sites (By similarity).. Isoform 3. Can act as dominant-negative. Binds DNA and have transctivation activity, even if much less efficiently than isoform 2. Does not inhibit cell proliferation (PubMed : 14660596).. Isoform 4. Directly and specifically enhances ribosomal DNA transcription interacting with RNA polymerase I-specific cofactors and inducing histone acetylation.

Sequence similarities

Belongs to the bZIP family. C/EBP subfamily.

Post-translational modifications

Phosphorylation at Ser-190 is required for interaction with CDK2, CDK4 and SWI/SNF complex leading to cell cycle inhibition. Dephosphorylated at Ser-190 by protein phosphatase 2A (PP2A) through PI3K/AKT signaling pathway regulation (PubMed:15107404). Phosphorylation at Thr-226 and Thr-230 by GSK3 is constitutive in adipose tissue and lung. In liver, both Thr-226 and Thr-230 are phosphorylated only during feeding but not during fasting. Phosphorylation of the GSK3 consensus sites selectively decreases transactivation activity on IRE-controlled promoters.. Sumoylated, sumoylation blocks the inhibitory effect on cell proliferation by disrupting the interaction with SMARCA2.. Ubiquitinated by COP1 upon interaction with TRIB1.

Subcellular localisation

Nucleus

Product protocols

Target data

Transcription factor that coordinates proliferation arrest and the differentiation of myeloid progenitors, adipocytes, hepatocytes, and cells of the lung and the placenta. Binds directly to the consensus DNA sequence 5'-T[TG]NNGNAA[TG]-3' acting as an activator on distinct target genes (PubMed : 11242107). During early embryogenesis, plays essential and redundant functions with CEBPB. Essential for the transition from common myeloid progenitors (CMP) to granulocyte/monocyte progenitors (GMP). Critical for the proper development of the liver and the lung (By similarity). Necessary for terminal adipocyte differentiation, is required for postnatal maintenance of systemic energy homeostasis and lipid storage (By similarity). To regulate these different processes at the proper moment and tissue, interplays with other transcription factors and modulators. Down-regulates the expression of genes that maintain cells in an undifferentiated and proliferative state through E2F1 repression, which is critical for its ability to induce adipocyte and granulocyte terminal differentiation. Reciprocally E2F1 blocks adipocyte differentiation by binding to specific promoters and repressing CEBPA binding to its target gene promoters. Proliferation arrest also depends on a functional binding to SWI/SNF complex (PubMed : 14660596). In liver, regulates gluconeogenesis and lipogenesis through different mechanisms. To regulate gluconeogenesis, functionally cooperates with FOXO1 binding to IRE-controlled promoters and regulating the expression of target genes such as PCK1 or G6PC1. To modulate lipogenesis, interacts and transcriptionally synergizes with SREBF1 in promoter activation of specific lipogenic target genes such as ACAS2. In adipose tissue, seems to act as FOXO1 coactivator accessing to ADIPOQ promoter through FOXO1 binding sites (By similarity).. Isoform 3. Can act as dominant-negative. Binds DNA and have transctivation activity, even if much less efficiently than isoform 2. Does not inhibit cell proliferation (PubMed : 14660596).. Isoform 4. Directly and specifically enhances ribosomal DNA transcription interacting with RNA polymerase I-specific cofactors and inducing histone acetylation.
See full target information CEBPA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com