JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196136

Recombinant human CECR2 protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human CECR2 protein (Active) is a Human Fragment protein, in the 430 to 543 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE, FuncS.

View Alternative Names

KIAA1740, CECR2, Chromatin remodeling regulator CECR2, Cat eye syndrome critical region protein 2

2 Images
Functional Studies - Recombinant human CECR2 protein (Active) (AB196136)
  • FuncS

Supplier Data

Functional Studies - Recombinant human CECR2 protein (Active) (AB196136)

Example data obtained using ab196136.

SDS-PAGE - Recombinant human CECR2 protein (Active) (AB196136)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human CECR2 protein (Active) (AB196136)

4-20% SDS-PAGE analysis of 3.2 μg ab196136 with Coomassie staining.

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

FuncS, SDS-PAGE

applications

Biologically active

Yes

Biological activity

Active

Accession

Q9BXF3

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.48% Tris, 0.04% Sorbitan monolaurate, ethoxylated, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p>Useful for the study of bromodomain binding assays, screening inhibitors and selectivity profiling.</p>" } } }

Sequence info

[{"sequence":"MHHHHHHTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFPGED","proteinLength":"Fragment","predictedMolecularWeight":"14.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":543,"aminoAcidStart":430,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9BXF3","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The CECR2 protein also known as Cat Eye Syndrome Chromosome Region Candidate 2 plays an important role in chromatin remodeling. It has a molecular mass of approximately 150 kDa. This protein functions as part of the CECR2-containing complex (CERF) which takes part in the regulation of nucleosome catalysis. CECR2 expresses in various tissues with notable expression in the testis brain and fetal tissue.
Biological function summary

The CECR2 protein engages in modulating transcriptional activity influencing the accessibility of DNA for transcription machinery. It acts as a component of the CERF complex integrating with multiple other proteins to facilitate these transcriptional adjustments. This action directly affects gene expression patterns critical for developmental processes particularly in neurogenesis and spermatogenesis.

Pathways

CECR2 interacts in the chromatin remodeling pathways essential for DNA replication and repair. The protein associates with SWI/SNF-like chromatin-remodeling complexes. These complexes enhance the efficient binding of transcriptional factors such as those of the BRG1/BRM-associated factor (BAF) complex. This interaction supports regulatory processes in embryonic development and cellular differentiation.

CECR2 mutations or dysregulation have strong links to neural tube defects and Cat Eye Syndrome. Neural tube defects result from improper closure of the neural tube during early embryonic development where CECR2 plays a regulatory role. The protein also relates to conditions involving altered chromatin structure. CECR2's relationship with other proteins involved in neural tube closure disorders like SHH (Sonic Hedgehog) highlights its relevance in these pathologies.

Specifications

Form

Liquid

General info

Function

Regulatory subunit of the ATP-dependent CERF-1 and CERF-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 15640247, PubMed : 22464331, PubMed : 26365797, PubMed : 28801535). The complexes do not have the ability to slide mononucleosomes to the center of a DNA template (PubMed : 28801535). The CERF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the CERF-5 ISWI chromatin remodeling complex (PubMed : 28801535). Plays a role in various processes during development : required during embryogenesis for neural tube closure and inner ear development. In adults, required for spermatogenesis, via the formation of ISWI-type chromatin complexes (By similarity). In histone-modifying complexes, CECR2 recognizes and binds acylated histones : binds histones that are acetylated and/or butyrylated (PubMed : 22464331, PubMed : 26365797). May also be involved through its interaction with LRPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis (PubMed : 11827465).

Product protocols

Target data

Regulatory subunit of the ATP-dependent CERF-1 and CERF-5 ISWI chromatin remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair (PubMed : 15640247, PubMed : 22464331, PubMed : 26365797, PubMed : 28801535). The complexes do not have the ability to slide mononucleosomes to the center of a DNA template (PubMed : 28801535). The CERF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the CERF-5 ISWI chromatin remodeling complex (PubMed : 28801535). Plays a role in various processes during development : required during embryogenesis for neural tube closure and inner ear development. In adults, required for spermatogenesis, via the formation of ISWI-type chromatin complexes (By similarity). In histone-modifying complexes, CECR2 recognizes and binds acylated histones : binds histones that are acetylated and/or butyrylated (PubMed : 22464331, PubMed : 26365797). May also be involved through its interaction with LRPPRC in the integration of cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling and cytokinesis (PubMed : 11827465).
See full target information CECR2

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com