JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB158097

Recombinant Human CENPE protein (GST tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CENPE protein (GST tag N-Terminus) is a Human Fragment protein, in the 309 to 419 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Centromere-associated protein E, Centromere protein E, Kinesin-7, Kinesin-related protein CENPE, CENP-E, CENPE

1 Images
SDS-PAGE - Recombinant Human CENPE protein (GST tag N-Terminus) (AB158097)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CENPE protein (GST tag N-Terminus) (AB158097)

ab158097 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

ELISA, WB

applications

Biologically active

No

Accession

Q02224

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"TPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLEEVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKR","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":419,"aminoAcidStart":309,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"Q02224","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CENPE also known as centromere-associated protein E or kinesin-like protein CENP-E plays a critical role in the alignment of chromosomes during mitosis. This protein with a molecular mass of approximately 312 kDa acts as a motor protein involved in chromosome movement. CENPE is mainly expressed in dividing cells and plays an important role during the metaphase stage of the cell cycle. The protein is localized at the kinetochores the protein complexes on chromatids where the spindle fibers attach during cell division.
Biological function summary

CENPE is a vital component for chromosome congression which ensures proper chromosome alignment and segregation. It is part of several essential complexes necessary for mitotic checkpoint signaling and the correction of chromosome-microtubule attachments. Without CENPE's function cells face increased risks of aneuploidy. The protein interacts with microtubules to drive the movement toward the center of the cell and is important in ensuring accurate cell division.

Pathways

CENPE is involved in the mitotic checkpoint and spindle assembly pathways. These pathways ensure the correct distribution of chromosomes during cell division and prevent genetic instability. CENPE interacts with other proteins such as BUBR1 and Mad2 which are integral parts of the mitotic checkpoint complex. Proper functioning of CENPE ensures the activation of these checkpoints preventing premature separation of chromatids and maintaining genomic integrity.

CENPE has links to various conditions characterized by chromosomal instability such as cancer. Aberrant expression or dysfunction of CENPE can lead to improper chromosome segregation contributing to aneuploidy a hallmark of many cancers. Moreover its function connects with other proteins like Aurora B kinase which also plays a role in chromosomal alignment and stability. Disruption in the functions of these proteins can promote tumor progression and malignancy.

Specifications

Form

Liquid

General info

Function

Microtubule plus-end-directed kinetochore motor which plays an important role in chromosome congression, microtubule-kinetochore conjugation and spindle assembly checkpoint activation. Drives chromosome congression (alignment of chromosomes at the spindle equator resulting in the formation of the metaphase plate) by mediating the lateral sliding of polar chromosomes along spindle microtubules towards the spindle equator and by aiding the establishment and maintenance of connections between kinetochores and spindle microtubules (PubMed : 23891108, PubMed : 25395579, PubMed : 7889940). The transport of pole-proximal chromosomes towards the spindle equator is favored by microtubule tracks that are detyrosinated (PubMed : 25908662). Acts as a processive bi-directional tracker of dynamic microtubule tips; after chromosomes have congressed, continues to play an active role at kinetochores, enhancing their links with dynamic microtubule ends (PubMed : 23955301). Suppresses chromosome congression in NDC80-depleted cells and contributes positively to congression only when microtubules are stabilized (PubMed : 25743205). Plays an important role in the formation of stable attachments between kinetochores and spindle microtubules (PubMed : 17535814) The stabilization of kinetochore-microtubule attachment also requires CENPE-dependent localization of other proteins to the kinetochore including BUB1B, MAD1 and MAD2. Plays a role in spindle assembly checkpoint activation (SAC) via its interaction with BUB1B resulting in the activation of its kinase activity, which is important for activating SAC. Necessary for the mitotic checkpoint signal at individual kinetochores to prevent aneuploidy due to single chromosome loss (By similarity).

Sequence similarities

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.

Post-translational modifications

The C-terminal inhibitory domain is phosphorylated. Phosphorylation relieves autoinhibition of the kinetochore motor (By similarity).. Sumoylated with SUMO2 and SUMO3. The sumoylation mediates the association to the kinetochore.

Subcellular localisation

Cytoskeleton

Product protocols

Target data

Microtubule plus-end-directed kinetochore motor which plays an important role in chromosome congression, microtubule-kinetochore conjugation and spindle assembly checkpoint activation. Drives chromosome congression (alignment of chromosomes at the spindle equator resulting in the formation of the metaphase plate) by mediating the lateral sliding of polar chromosomes along spindle microtubules towards the spindle equator and by aiding the establishment and maintenance of connections between kinetochores and spindle microtubules (PubMed : 23891108, PubMed : 25395579, PubMed : 7889940). The transport of pole-proximal chromosomes towards the spindle equator is favored by microtubule tracks that are detyrosinated (PubMed : 25908662). Acts as a processive bi-directional tracker of dynamic microtubule tips; after chromosomes have congressed, continues to play an active role at kinetochores, enhancing their links with dynamic microtubule ends (PubMed : 23955301). Suppresses chromosome congression in NDC80-depleted cells and contributes positively to congression only when microtubules are stabilized (PubMed : 25743205). Plays an important role in the formation of stable attachments between kinetochores and spindle microtubules (PubMed : 17535814) The stabilization of kinetochore-microtubule attachment also requires CENPE-dependent localization of other proteins to the kinetochore including BUB1B, MAD1 and MAD2. Plays a role in spindle assembly checkpoint activation (SAC) via its interaction with BUB1B resulting in the activation of its kinase activity, which is important for activating SAC. Necessary for the mitotic checkpoint signal at individual kinetochores to prevent aneuploidy due to single chromosome loss (By similarity).
See full target information CENPE

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com