JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB160295

Recombinant Human CH25H protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CH25H protein is a Human Full Length protein, in the 1 to 272 aa range, expressed in Wheat germ, suitable for ELISA, WB.

View Alternative Names

Cholesterol 25-hydroxylase, Cholesterol 25-monooxygenase, h25OH, CH25H

1 Images
SDS-PAGE - Recombinant Human CH25H protein (AB160295)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CH25H protein (AB160295)

ab160295 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Key facts

Expression system

Wheat germ

Tags

GST tag N-Terminus

Applications

WB, ELISA

applications

Biologically active

No

Accession

O95992

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 0.79% Tris HCl, 0.31% Glutathione

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRRYKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFFVWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":272,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Wheat germ","accessionNumber":"O95992","tags":[{"tag":"GST","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The CH25H protein also known as cholesterol 25-hydroxylase catalyzes the conversion of cholesterol into 25-hydroxycholesterol. This enzyme has a mass of approximately 33 kDa. It expresses widely in tissues but its level of expression is highest in macrophages and the liver. The protein is part of the enzymatic group that modulates lipid homeostasis and is integral to host defense mechanisms.
Biological function summary

Cholesterol 25-hydroxylase plays a significant role in lipid metabolism and immune regulation. It produces 25-hydroxycholesterol a potent oxysterol which exerts effects on lipid metabolic processes and immune cell signaling. While not part of a large multiprotein complex CH25H's activity impacts cellular cholesterol levels and potentially influences the production of certain signaling molecules.

Pathways

Cholesterol 25-hydroxylase contributes to the regulation of lipid metabolic pathways and innate immune responses. Within the lipid metabolism pathway CH25H interacts with proteins like LXR (liver X receptor) affecting cholesterol homeostasis. The enzyme also influences immune regulation by altering the production of signaling molecules that modulate the interferon response affecting pathways related to inflammation and innate immunity.

Cholesterol 25-hydroxylase has connections to atherosclerosis and viral infections. In the context of atherosclerosis its function in regulating cholesterol levels can influence plaque formation in arteries. The protein's involvement in immune response modulation links it to the body's defense against viral infections. Additionally CH25H's activity interacts with proteins involved in the immune response such as IFN-induced proteins to mount an antiviral state.

Specifications

Form

Liquid

General info

Function

Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes (PubMed : 9852097). Plays a key role in cell positioning and movement in lymphoid tissues : 25-hydroxycholesterol is an intermediate in biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC), an oxysterol that acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for a number of lymphoid cells (By similarity). May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing (PubMed : 9852097). As an interferon-stimulated gene, has broad antiviral activities against a wide range of enveloped viruses, such as vesicular stomatitis virus (VSV) and SARS coronavirus-2 (SARS-CoV-2). Its product, 25-hydroxycholesterol, activates the ER-localized enzyme ACAT to induce internalization of accessible cholesterol on the plasma membrane and restricts SARS-CoV-2 S protein-mediated fusion which inhibits virus replication (PubMed : 32944968, PubMed : 33239446). In testis, production of 25-hydroxycholesterol by macrophages plays a role in Leydig cell differentiation (By similarity). Required to restrain inflammation in macrophages : production of 25-hydroxycholesterol protects macrophages from cholesterol overload, thereby preventing mitochondrial DNA release and subsequent activation of the AIM2 inflammasome (By similarity).

Sequence similarities

Belongs to the sterol desaturase family.

Post-translational modifications

N-glycosylated.

Product protocols

Target data

Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes (PubMed : 9852097). Plays a key role in cell positioning and movement in lymphoid tissues : 25-hydroxycholesterol is an intermediate in biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC), an oxysterol that acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for a number of lymphoid cells (By similarity). May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing (PubMed : 9852097). As an interferon-stimulated gene, has broad antiviral activities against a wide range of enveloped viruses, such as vesicular stomatitis virus (VSV) and SARS coronavirus-2 (SARS-CoV-2). Its product, 25-hydroxycholesterol, activates the ER-localized enzyme ACAT to induce internalization of accessible cholesterol on the plasma membrane and restricts SARS-CoV-2 S protein-mediated fusion which inhibits virus replication (PubMed : 32944968, PubMed : 33239446). In testis, production of 25-hydroxycholesterol by macrophages plays a role in Leydig cell differentiation (By similarity). Required to restrain inflammation in macrophages : production of 25-hydroxycholesterol protects macrophages from cholesterol overload, thereby preventing mitochondrial DNA release and subsequent activation of the AIM2 inflammasome (By similarity).
See full target information CH25H

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com