JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB139206

Recombinant Human CHMP1a protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CHMP1a protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 196 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

CHMP1, KIAA0047, PCOLN3, PRSM1, CHMP1A, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1, CHMP1a, Vps46-1, hVps46-1

1 Images
SDS-PAGE - Recombinant Human CHMP1a protein (His tag N-Terminus) (AB139206)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CHMP1a protein (His tag N-Terminus) (AB139206)

15% SDS-PAGE analysis of ab139206 (3μg)

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q9HD42

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSMDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN","proteinLength":"Full Length","predictedMolecularWeight":"24.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":196,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9HD42","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The protein charged multivesicular body protein 1a (CHMP1a) is an essential component of the endosomal sorting complex required for transport (ESCRT)-III also known as chromatin-modifying protein 1A. CHMP1a has a molecular mass of approximately 22 kDa. It shows expression in various tissues with significant presence observed in the brain liver and kidneys. CHMP1a plays a role in the cellular process of membrane remodeling and vesicle trafficking.
Biological function summary

CHMP1a assists in cellular processes like cytokinesis and maintenance of chromatin structure. It is an important part of the ESCRT-III complex which is important for the final stages of cell division and intracellular sorting processes. CHMP1a contributes to the degradation of membrane proteins in lysosomes and the maintenance of proper cell function by controlling the fate of cell surface receptors.

Pathways

The ESCRT-III complex including CHMP1a is involved in the endosomal-lysosomal degradation pathway. This pathway plays a critical role in the down-regulation of cell signaling. CHMP1a associates with proteins such as VPS4 which is involved in the disassembly and recycling of the ESCRT-III complex for repeated use in successive cell cycles. CHMP1a also contributes to the proper functioning of the mitotic spindle assembly ensuring successful mitosis.

Defects or mutations in CHMP1a expression can associate with neurodegenerative diseases like frontotemporal dementia. Research shows implications in cancer with altered CHMP1a expression affecting tumor progression due to disrupted cell division and regulation. The proteins within its pathways such as TSG101 and ALIX also exhibit connections to oncogenic processes further highlighting the role of CHMP1a in pathological conditions.

Specifications

Form

Liquid

Additional notes

ab139206 was purified by using conventional chromatography techniques.

General info

Function

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing.

Sequence similarities

Belongs to the SNF7 family.

Subcellular localisation

Endosome membrane

Product protocols

Target data

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing.
See full target information CHMP1A

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com