JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB126679

Recombinant Human CHMP1B protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(1 Publication)

Recombinant Human CHMP1B protein (His tag N-Terminus) is a Human Full Length protein, in the 1 to 199 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE, Mass Spec.

View Alternative Names

C18orf2, CHMP1B, Charged multivesicular body protein 1b, CHMP1.5, Chromatin-modifying protein 1b, Vacuolar protein sorting-associated protein 46-2, CHMP1b, Vps46-2, hVps46-2

1 Images
SDS-PAGE - Recombinant Human CHMP1B protein (His tag N-Terminus) (AB126679)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human CHMP1B protein (His tag N-Terminus) (AB126679)

15% SDS-PAGE showing ab126679 (3 µg). Please note : Molecular weight on SDS-PAGE will appear higher.

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE, Mass Spec

applications

Biologically active

No

Accession

Q7LBR1

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride, 0.32% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Mass Spec": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MGSSHHHHHHSSGLVPRGSHMGSHMSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVTSVASAEQDELSQRLARLRDQV","proteinLength":"Full Length","predictedMolecularWeight":"24.7 kDa","actualMolecularWeight":null,"aminoAcidEnd":199,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q7LBR1","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

CHMP1B also known as Chromatin Modifying Protein 1B is a component of the ESCRT-III (Endosomal Sorting Complex Required for Transport-III) machinery. This protein has a molecular mass of approximately 23 kDa. It is expressed in various tissues particularly showing a strong presence in brain and kidney tissues. Mechanically CHMP1B plays a role in membrane fission and repair processes contributing to cellular activities such as cytokinesis and endosomal sorting.
Biological function summary

CHMP1B plays a significant role in the proper functioning of cellular processes involving vesicle trafficking and organelle biogenesis. It forms part of the ESCRT-III complex which facilitates the scission of membrane bud necks. This activity is vital for the final stages of cytokinesis as well as in the formation of multivesicular bodies. These functions contribute to maintaining cellular structure and homeostasis.

Pathways

CHMP1B is involved in the ESCRT pathway which is integral to endosomal sorting and membrane remodeling processes. This pathway associates closely with proteins like VPS4 which regulates the disassembly and recycling of ESCRT-III complexes. Additionally CHMP1B participates in the pathway of cytokinesis where it collaborates with proteins such as ALIX to ensure the successful separation of dividing cells.

Disturbances in CHMP1B functionality have associations with neurodegenerative diseases and cancer. Abnormal expression of CHMP1B is frequently observed in neurodegenerative conditions connecting it with other proteins like CHMP2B known for involvement in similar disorders. Furthermore alterations in the expression or function of CHMP1B can contribute to oncogenic processes highlighting its relationship with proteins like Brox that participate in related tumorigenic pathways.

Specifications

Form

Liquid

Additional notes

ab126679 is purified by using conventional chromatography techniques.

General info

Function

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells. Involved in HIV-1 p6- and p9-dependent virus release.

Sequence similarities

Belongs to the SNF7 family.

Subcellular localisation

Endosome

Product protocols

Target data

Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B and SPAST to the midbody of dividing cells. Involved in HIV-1 p6- and p9-dependent virus release.
See full target information CHMP1B

Publications (1)

Recent publications for all applications. Explore the full list and refine your search

Frontiers in pharmacology 12:704040 PubMed34671253

2021

var. for Treating Rheumatoid Arthritis-An Assessment Combining Machine Learning-Guided ADME Properties Prediction, Network Pharmacology, and Pharmacological Assessment.

Applications

Unspecified application

Species

Unspecified reactive species

Xiuhuan Wang,Youyi Sun,Ling Ling,Xueyang Ren,Xiaoyun Liu,Yu Wang,Ying Dong,Jiamu Ma,Ruolan Song,Axiang Yu,Jing Wei,Qiqi Fan,Miaoxian Guo,Tiantian Zhao,Rina Dao,Gaimei She
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com