JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB85339

Recombinant Human Chromogranin A protein (Tag Free)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Chromogranin A protein (Tag Free) is a Human Fragment protein, in the 19 to 131 aa range, expressed in Escherichia coli, with >95%, suitable for SDS-PAGE.

View Alternative Names

Chromogranin-A, CgA, Pituitary secretory protein I, SP-I, CHGA

1 Images
SDS-PAGE - Recombinant Human Chromogranin A protein (Tag Free) (AB85339)
  • SDS-PAGE

Unknown

SDS-PAGE - Recombinant Human Chromogranin A protein (Tag Free) (AB85339)

15% SDS-PAGE showing ab85339 at approximately 12.8kDa (3μg).

Key facts

Purity

>95% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10645

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.316% Tris HCl

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Vasostatin 2 is the N-terminal fragment (19-131 aa) derived from the cleavage of chromogranin A (CgA) which is a member of the chromogranin/secretogranin(granins) family of neuroendocrine secretory proteins. Vasostatin 2 has been shown to exert several biological activities on several tissues and organs and exerts a large spectrum of homeostatic actions, including antifungal and antimicrobial effect, modulation of cell adhesion, and inhibition of parathyroid hormone secretion.

Sequence info

[{"sequence":"MLPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVME","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":131,"aminoAcidStart":19,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10645","tags":[]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Chromogranin A (CgA) sometimes called chromagranin A is a glycoprotein with a molecular weight of approximately 49–52 kDa. It is highly expressed in the secretory granules of neuroendocrine cells present in tissues such as the adrenal medulla pancreas and endocrine cells of the gastrointestinal tract. CgA identified as part of a family including chromogranin B and chromogranin C functions mechanically as a precursor to various bioactive peptides. This translates into its involvement in the storage and release of hormones and peptides within vesicles.
Biological function summary

Chromogranin A assists in the regulation of secretory pathways across multiple neuroendocrine systems. It plays a role in hormone storage conversion to active peptides and regulates the exocytosis of hormones. CgA acts within a complex contributing to secretory granule biogenesis and influencing intravesicular acidity. As a regulatory component the exact physiological roles are diverse impacting cardiovascular metabolic and immunological processes.

Pathways

Chromogranin A is involved in pathways such as the catecholamine synthesis and release pathway and the serotonergic pathway. Within these pathways it interacts with proteins like secretogranin II and parathyroid hormone (PTH). These interactions modulate neurotransmitter storage and secretion across various systems. CgA's bioactive peptides also contribute to modulating physiological processes like vasoconstriction and insulin regulation linking it closely with these signaling cascades.

Chromogranin A is a known marker for neuroendocrine tumors where its levels in blood may increase due to tumor activity. It links to diseases like pheochromocytoma and carcinoid tumors where improper regulation of CgA-associated pathways occurs. Additionally its connection to parathyroid disorders through the PTH pathway illustrates its broader implication in endocrine pathophysiology. CgA serves as an invaluable diagnostic and prognostic tool in these disease states and supports the development of targeted therapies.

Specifications

Form

Liquid

Additional notes

ab85339 is purified using conventional chromatography techniques.Endotoxin level: < 1.0 EU per 1 μg of protein (determined by LAL method).

General info

Function

Pancreastatin. Strongly inhibits glucose induced insulin release from the pancreas.. Catestatin. Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist (PubMed : 15326220). Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa (PubMed : 15723172, PubMed : 24723458). Can induce mast cell migration, degranulation and production of cytokines and chemokines (PubMed : 21214543). Acts as a potent scavenger of free radicals in vitro (PubMed : 24723458). May play a role in the regulation of cardiac function and blood pressure (PubMed : 18541522).. Serpinin. Regulates granule biogenesis in endocrine cells by up-regulating the transcription of protease nexin 1 (SERPINE2) via a cAMP-PKA-SP1 pathway. This leads to inhibition of granule protein degradation in the Golgi complex which in turn promotes granule formation.

Sequence similarities

Belongs to the chromogranin/secretogranin protein family.

Post-translational modifications

Sulfated on tyrosine residues and/or contains sulfated glycans.. O-glycosylated with core 1 or possibly core 8 glycans (PubMed:19838169, PubMed:23234360, PubMed:9852066). Contains chondroitin sulfate (CS); CS attachment is pH-dependent, being observed at mildly acidic conditions of pH 5 but not at neutral pH, and promotes self-assembly in vitro (PubMed:25326458).. Proteolytic processing gives rise to an additional longer form of catestatin (residues 358-390) which displays a less potent catecholamine release-inhibitory activity (PubMed:10781584). Plasmin-mediated proteolytic processing can give rise to additional shorter and longer forms of catestatin peptides (PubMed:17991725).

Product protocols

Target data

Pancreastatin. Strongly inhibits glucose induced insulin release from the pancreas.. Catestatin. Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist (PubMed : 15326220). Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa (PubMed : 15723172, PubMed : 24723458). Can induce mast cell migration, degranulation and production of cytokines and chemokines (PubMed : 21214543). Acts as a potent scavenger of free radicals in vitro (PubMed : 24723458). May play a role in the regulation of cardiac function and blood pressure (PubMed : 18541522).. Serpinin. Regulates granule biogenesis in endocrine cells by up-regulating the transcription of protease nexin 1 (SERPINE2) via a cAMP-PKA-SP1 pathway. This leads to inhibition of granule protein degradation in the Golgi complex which in turn promotes granule formation.
See full target information CHGA

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com