JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314531

Recombinant human Claudin 4 protein - Active (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Claudin 4 protein - Active (His tag) is a Human Full Length protein, in the 1 to 209 aa range, expressed in Mammalian, < 1 EU/µg endotoxin level, suitable for WB, FuncS.

View Alternative Names

CPER, CPETR1, WBSCR8, CLDN4, Claudin-4, Clostridium perfringens enterotoxin receptor, Williams-Beuren syndrome chromosomal region 8 protein, CPE-R, CPE-receptor

2 Images
Functional Studies - Recombinant human Claudin 4 protein - Active (His tag) (AB314531)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Claudin 4 protein - Active (His tag) (AB314531)

Measured by its binding ability in a functional ELISA. ab314531 at 5 μg/mL can bind an Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.

Western blot - Recombinant human Claudin 4 protein - Active (His tag) (AB314531)
  • WB

Supplier Data

Western blot - Recombinant human Claudin 4 protein - Active (His tag) (AB314531)

All lanes:

mouse anti-6*His monoclonal antibody

All lanes:

Western blot - Recombinant human Claudin 4 protein - Active (His tag) (ab314531)

false

Key facts

Endotoxin level

< 1 EU/µg

Expression system

Mammalian

Tags

His tag C-Terminus

Applications

WB, FuncS

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. AB314531 at 5 μg/mL can bind an Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.

Accession

O14493

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.14% PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

ab314531 is a VLP-CLDN4 protein complex.

Sequence info

[{"sequence":"MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV","proteinLength":"Full Length","predictedMolecularWeight":"23.4 kDa","actualMolecularWeight":null,"aminoAcidEnd":209,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"O14493","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C|-80°C
Aliquoting information
Add glycerol to a final volume of 50% for extra stability and aliquot
Storage information
The product can be stored for up to 12 months
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Claudin-4 also known as CLDN4 is a protein essential for tight junctions which are critical in maintaining the permeability barrier of epithelial cells. The protein has a molecular mass of approximately 22 kDa. Claudin-4 expresses notably in epithelial cells of various tissues including the kidney lung and gastrointestinal tract. In addition to its presence in normal tissues claudin-4 can also exhibit heightened expression in certain cancerous tissues making it a subject of interest in oncology research.
Biological function summary

Claudin-4 plays a significant role in paracellular transport and cell polarity. By assembling into complexes with other claudins and tight junction proteins claudin-4 regulates the selective permeability and homeostasis across cell layers. It functions as a component of tight junction strands contributing to their barrier properties. Interaction with proteins such as occludin and ZO-1 further defines its role in tight junction structure and function.

Pathways

Claudin-4 participates in critical biological processes such as epithelial cell signaling and apoptosis regulation. It interfaces with the epithelial-to-mesenchymal transition (EMT) pathway where claudin-4 expression influences cellular adhesion and motility. Claudin-4 also interacts with related claudin proteins in these pathways contributing to structural arrangement and pathway signaling precision.

Claudin-4 has associations with several types of cancers including pancreatic and ovarian cancer. Its consistent overexpression in these conditions suggests its involvement in tumorigenesis and metastasis. In the context of ovarian cancer claudin-4 may interact with proteins such as mesothelin which plays a role in cell adhesion and tumor progression. Investigating claudin-4's involvement in cancer can provide insights into potential therapeutic targets and diagnostic markers.

Specifications

Form

Lyophilized

Additional notes

Purification technique - Centrifugation.

General info

Function

Can associate with other claudins to regulate tight junction structural and functional strand dynamics (PubMed : 35773259, PubMed : 36008380). May coassemble with CLDN8 into tight junction strands containing anion-selective channels that convey paracellular chloride permeability in renal collecting ducts (By similarity) (PubMed : 36008380). May integrate into CLDN3 strands to modulate localized tight junction barrier properties (PubMed : 35773259, PubMed : 36008380). May disrupt strand assembly of channel-forming CLDN2 and CLDN15 and inhibit cation conductance (PubMed : 35773259, PubMed : 36008380). Cannot form tight junction strands on its own (PubMed : 35773259, PubMed : 36008380).

Sequence similarities

Belongs to the claudin family.

Post-translational modifications

Phosphorylated. Phosphorylation by EPHA2 is stimulated by EFNA1 and alters interaction with TJP1.

Product protocols

Target data

Can associate with other claudins to regulate tight junction structural and functional strand dynamics (PubMed : 35773259, PubMed : 36008380). May coassemble with CLDN8 into tight junction strands containing anion-selective channels that convey paracellular chloride permeability in renal collecting ducts (By similarity) (PubMed : 36008380). May integrate into CLDN3 strands to modulate localized tight junction barrier properties (PubMed : 35773259, PubMed : 36008380). May disrupt strand assembly of channel-forming CLDN2 and CLDN15 and inhibit cation conductance (PubMed : 35773259, PubMed : 36008380). Cannot form tight junction strands on its own (PubMed : 35773259, PubMed : 36008380).
See full target information CLDN4

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com