JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB314532

Recombinant human Claudin 6 protein - Active (His tag)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human Claudin 6 protein - Active (His tag) is a Human Full Length protein, in the 1 to 220 aa range, expressed in Mammalian, < 1 EU/µg endotoxin level, suitable for WB, FuncS.

View Alternative Names

UNQ757/PRO1488, CLDN6, Claudin-6, Skullin

2 Images
Functional Studies - Recombinant human Claudin 6 protein - Active (His tag) (AB314532)
  • FuncS

Supplier Data

Functional Studies - Recombinant human Claudin 6 protein - Active (His tag) (AB314532)

Measured by its binding ability in a functional ELISA. ab314532 at 10 μg/mL can bind an Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL

Western blot - Recombinant human Claudin 6 protein - Active (His tag) (AB314532)
  • WB

Supplier Data

Western blot - Recombinant human Claudin 6 protein - Active (His tag) (AB314532)

All lanes:

mouse anti-6*His monoclonal antibody

All lanes:

Western blot - Recombinant human Claudin 6 protein - Active (His tag) (ab314532)

false

Key facts

Endotoxin level

< 1 EU/µg

Expression system

Mammalian

Tags

His tag C-Terminus

Applications

FuncS, WB

applications

Biologically active

Yes

Biological activity

Measured by its binding ability in a functional ELISA. AB314532 at 10 μg/mL can bind an Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/mL

Accession

P56747

Animal free

Yes

Carrier free

No

Species

Human

Reconstitution

Reconstitute in water

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 0.87% Sodium chloride, 0.24% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "WB": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20degC/-80degC. Our default final concentration of glycerol is 50%.

Sequence info

[{"sequence":"MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV","proteinLength":"Full Length","predictedMolecularWeight":"25.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":220,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Mammalian","accessionNumber":"P56747","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage conditions
-20°C|-80°C
Appropriate long-term storage conditions
-20°C|-80°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Claudin 6 also known as CLDN6 is a transmembrane protein belonging to the claudin family. This family is critical in forming tight junctions between cells which regulate the paracellular barrier functions of epithelia. The molecular mass of claudin 6 is approximately 23 kDa. Researchers have observed its expression mainly in embryonic tissues and certain cancer types. In normal adult tissues it shows limited expression indicating a specific role during early developmental stages.
Biological function summary

Claudin 6 participates in the formation and maintenance of tight junctions in epithelial cells. It is part of a larger complex that includes multiple claudins and other tight junction proteins like occludin and zonula occludens-1. This complex maintains cellular polarity and controls the flow of ions and molecules between cells which is essential for tissue homeostasis. Its expression pattern suggests a role in cell differentiation and proliferation during embryogenesis and tumorigenesis.

Pathways

Various studies indicate that claudin 6 is involved in the Wnt signaling pathway which is key in embryonic development and cell differentiation. This pathway interacts with several other proteins including β-catenin to mediate gene expression and cellular functions. Additionally claudin 6 contributes to pathways influencing the epithelial-mesenchymal transition (EMT) a process necessary for organ development and cancer metastasis. Through these pathways claudin 6 interacts with diverse proteins to modulate cell behavior.

Researchers have linked claudin 6 to certain cancers particularly ovarian and breast cancer. Its aberrant expression may contribute to tumor progression and invasiveness. Claudin 6 can promote changes in the tumor microenvironment by interacting with other cell junction proteins possibly influencing cancer cell proliferation and spread. Furthermore its altered expression is noted in immune disorders suggesting potential roles in pathogenesis through interactions with immune cells or signaling molecules like cytokines within the immune pathways.

Specifications

Form

Lyophilized

Additional notes

Purification technique - Centrifugation.

General info

Function

Plays a major role in tight junction-specific obliteration of the intercellular space.. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.

Sequence similarities

Belongs to the claudin family.

Product protocols

Target data

Plays a major role in tight junction-specific obliteration of the intercellular space.. (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
See full target information CLDN6

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com