JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB177715

Recombinant Human Clusterin protein (His tag N-Terminus)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human Clusterin protein (His tag N-Terminus) is a Human Full Length protein, in the 23 to 449 aa range, expressed in Escherichia coli, with >85%, suitable for SDS-PAGE.

View Alternative Names

APOJ, CLI, KUB1, AAG4, CLU, Clusterin, Aging-associated gene 4 protein, Apolipoprotein J, Complement cytolysis inhibitor, Ku70-binding protein 1, NA1/NA2, Sulfated glycoprotein 2, Testosterone-repressed prostate message 2, Apo-J, SGP-2, TRPM-2

1 Images
SDS-PAGE - Recombinant Human Clusterin protein (His tag N-Terminus) (AB177715)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human Clusterin protein (His tag N-Terminus) (AB177715)

15% SDS-PAGE analysis of ab177715 (3μg).

Key facts

Purity

>85% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P10909

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 10% Glycerol (glycerin, glycerine), 0.88% Sodium chloride, 0.3152% Tris HCl, 0.02% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE","proteinLength":"Full Length","predictedMolecularWeight":"54.1 kDa","actualMolecularWeight":null,"aminoAcidEnd":449,"aminoAcidStart":23,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P10909","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

Clusterin also known as Apolipoprotein J (ApoJ) is a glycoprotein with a mass of approximately 75-80 kDa. Scientists find clusterin expressed widely in the human body including the brain kidney and reproductive organs. This protein exists in two isoforms a secreted form and a nuclear form each with different locations and functions within the cells.
Biological function summary

Clusterin plays multiple roles particularly in lipid transport apoptosis and cell-cell interactions. It does not form part of a larger protein complex but it acts as a molecular chaperone that helps in folding and clearance of damaged proteins. This capability allows clusterin to protect cells against stress conditions such as oxidative stress by preventing abnormal protein aggregation.

Pathways

Clusterin is involved in pathways related to cell survival and lipid metabolism. It plays a role in the insulin signaling pathway and interacts with proteins like Heat Shock Protein 70 (HSP70) to assist in protein folding and in the activation of apoptotic pathways when needed. Clusterin's function in these processes helps in maintaining cellular homeostasis.

Scientists associate clusterin with Alzheimer’s disease and cancer progression. Elevated levels of clusterin have been observed in Alzheimer's patients suggesting a role in amyloid-beta plaque formation. In cancer clusterin expression influences tumor progression and resistance to therapies. Its interaction with other proteins such as Bax modulates the apoptotic pathways impacting cancer cell survival and chemotherapy resistance.

Specifications

Form

Liquid

Additional notes

ab177715 was purified using conventional chromatography techniques.

General info

Function

Isoform 1. Functions as extracellular chaperone that prevents aggregation of non native proteins (PubMed : 11123922, PubMed : 19535339). Prevents stress-induced aggregation of blood plasma proteins (PubMed : 11123922, PubMed : 12176985, PubMed : 17260971, PubMed : 19996109). Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro) (PubMed : 12047389, PubMed : 17407782, PubMed : 17412999). Does not require ATP (PubMed : 11123922). Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70 (PubMed : 11123922). Does not refold proteins by itself (PubMed : 11123922). Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation (PubMed : 21505792). Protects cells against apoptosis and against cytolysis by complement (PubMed : 2780565). Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 20068069). Promotes proteasomal degradation of COMMD1 and IKBKB (PubMed : 20068069). Modulates NF-kappa-B transcriptional activity (PubMed : 12882985). A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis (PubMed : 16113678, PubMed : 17689225). Plays a role in the regulation of cell proliferation (PubMed : 19137541). An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5 (PubMed : 22689054). Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed : 24073260). Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3 (By similarity). Plays a role in the clearance of immune complexes that arise during cell injury (By similarity).. Isoform 6. Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.. Isoform 4. Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed : 24073260). Promotes cell death through interaction with BCL2L1 that releases and activates BAX (PubMed : 21567405).

Sequence similarities

Belongs to the clusterin family.

Post-translational modifications

Proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen (PubMed:2387851). Proteolytic cleavage is not necessary for its chaperone activity (PubMed:25402950). All non-secreted forms are not proteolytically cleaved (PubMed:24073260). Chaperone activity of uncleaved forms is dependent on a non-reducing environment (PubMed:25402950).. Polyubiquitinated, leading to proteasomal degradation (PubMed:17451556, PubMed:19137541). Under cellular stress, the intracellular level of cleaved form is reduced due to proteasomal degradation (PubMed:17451556).. Extensively glycosylated with sulfated N-linked carbohydrates (PubMed:17260971, PubMed:2387851). About 30% of the protein mass is comprised of complex N-linked carbohydrate (PubMed:2387851). Endoplasmic reticulum (ER) stress induces changes in glycosylation status and increases level of hypoglycosylated forms (PubMed:22689054). Core carbohydrates are essential for chaperone activity (PubMed:25402950). Non-secreted forms are hypoglycosylated or unglycosylated (PubMed:24073260).

Subcellular localisation

Nucleus

Product protocols

Target data

Isoform 1. Functions as extracellular chaperone that prevents aggregation of non native proteins (PubMed : 11123922, PubMed : 19535339). Prevents stress-induced aggregation of blood plasma proteins (PubMed : 11123922, PubMed : 12176985, PubMed : 17260971, PubMed : 19996109). Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro) (PubMed : 12047389, PubMed : 17407782, PubMed : 17412999). Does not require ATP (PubMed : 11123922). Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70 (PubMed : 11123922). Does not refold proteins by itself (PubMed : 11123922). Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation (PubMed : 21505792). Protects cells against apoptosis and against cytolysis by complement (PubMed : 2780565). Intracellular forms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed : 20068069). Promotes proteasomal degradation of COMMD1 and IKBKB (PubMed : 20068069). Modulates NF-kappa-B transcriptional activity (PubMed : 12882985). A mitochondrial form suppresses BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis (PubMed : 16113678, PubMed : 17689225). Plays a role in the regulation of cell proliferation (PubMed : 19137541). An intracellular form suppresses stress-induced apoptosis by stabilizing mitochondrial membrane integrity through interaction with HSPA5 (PubMed : 22689054). Secreted form does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed : 24073260). Secreted form act as an important modulator during neuronal differentiation through interaction with STMN3 (By similarity). Plays a role in the clearance of immune complexes that arise during cell injury (By similarity).. Isoform 6. Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity.. Isoform 4. Does not affect caspase or BAX-mediated intrinsic apoptosis and TNF-induced NF-kappa-B-activity (PubMed : 24073260). Promotes cell death through interaction with BCL2L1 that releases and activates BAX (PubMed : 21567405).
See full target information CLU

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com