JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB196077

Recombinant Human CoREST protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human CoREST protein is a Human Fragment protein, in the 305 to 482 aa range, expressed in Escherichia coli, with >80%, suitable for SDS-PAGE.

View Alternative Names

KIAA0071, RCOR, RCOR1, REST corepressor 1, Protein CoREST

1 Images
SDS-PAGE - Recombinant Human CoREST protein (AB196077)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human CoREST protein (AB196077)

4-20% SDS-PAGE analysis of 2 μg ab196077 with Coomassie staining.

Key facts

Purity

>80% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag N-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

Q9UKL0

Animal free

No

Carrier free

No

Species

Human

Storage buffer

pH: 8 Constituents: 20% Glycerol (glycerin, glycerine), 0.64% Sodium chloride, 0.63% Tris HCl, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 0.02% Potassium chloride

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"RAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS","proteinLength":"Fragment","predictedMolecularWeight":"20 kDa","actualMolecularWeight":null,"aminoAcidEnd":482,"aminoAcidStart":305,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"Q9UKL0","tags":[{"tag":"His","terminus":"N-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The CoREST protein also known as REST corepressor 1 is a 58 kDa protein that mechanically functions in chromatin remodeling and gene silencing. CoREST localizes to the nucleus and functions in the repression of neuronal genes in non-neuronal tissues. This protein is pivotal in assembling histone deacetylase complexes which makes it essential in epigenetic regulation. CoREST is expressed in various tissues throughout the body playing an important role in maintaining non-neuronal gene expression.
Biological function summary

CoREST interacts with multiple partners to form a corepressor complex. This complex includes LSD1 (lysine-specific demethylase 1) and HDAC1/2 (histone deacetylases 1 or 2) facilitating transcriptional repression. CoREST regulates the expression of genes involved in neurogenesis and cell differentiation processes. Its role is critical in maintaining the balance between neuronal and non-neuronal gene expression by modifying chromatin states.

Pathways

CoREST is involved in histone modification and gene expression regulation pathways. One significant pathway is the REST (RE1-Silencing Transcription factor) pathway where CoREST serves as a core component. In this pathway CoREST interacts with REST a transcriptional repressor to silence neural genes in a non-neuronal context. Another involved pathway is the chromatin remodeling pathway where CoREST associates with LSD1 and other chromatin-modifying enzymes to alter chromatin structure and gene accessibility.

CoREST has connections to neurological disorders and cancer. Altered CoREST expression or function links to the progression of neurodegenerative diseases such as Huntington's disease. CoREST dysregulation also relates to certain cancer types where misexpression can contribute to tumorigenesis. In the context of these disorders CoREST often collaborates with LSD1 affecting the transcriptional landscape of affected cells showcasing the importance of CoREST in disease mechanisms.

Specifications

Form

Liquid

General info

Function

Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.

Sequence similarities

Belongs to the CoREST family.

Post-translational modifications

Phosphorylated by HSV-1 protein kinases in case of infection.

Subcellular localisation

Nucleus

Product protocols

Target data

Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.
See full target information RCOR1

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com