JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB277613

Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active)

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) is a SARS-CoV-2 Full Length protein, in the 4254 to 4392 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE, FuncS.

View Alternative Names

1a-1b, rep, Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein

3 Images
Functional Studies - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)
  • FuncS

Supplier Data

Functional Studies - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)

The specific activity of ab277613 was determined to be 53 pmol /min/mg in a methyltransferase activity assay using an RNA cap structure analog - m7G(5')ppp(5')A - as substrate.

Functional Studies - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)
  • FuncS

Supplier Data

Functional Studies - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)

The specific activity of ab277613 was determined to be 53 pmol /min/mg in a methyltransferase activity assay

SDS-PAGE - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human coronavirus SARS-CoV-2 Nsp10 + Nsp16 methyltransferase protein (Active) (AB277613)

SDS-PAGE analysis of ab277613.

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

Tag free

Applications

SDS-PAGE, FuncS

applications

Biologically active

Yes

Biological activity

The specific activity of ab277613 was determined to be 53 pmol /min/mg in a methyltransferase assay.

Accession

P0DTD1

Animal free

Yes

Carrier free

No

Species

SARS-CoV-2

Storage buffer

pH: 7 Preservative: 1.02% Imidazole Constituents: 70.8662% Water, 25% Glycerol (glycerin, glycerine), 1.75% Sodium chloride, 1.34% Sodium phosphate, 0.0038% (R*,R*)-1,4-Dimercaptobutan-2,3-diol

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":4392,"aminoAcidStart":4254,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0DTD1","tags":[{"tag":"His","terminus":"C-Terminus"}]},{"sequence":"SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN","proteinLength":"Full Length","predictedMolecularWeight":null,"actualMolecularWeight":null,"aminoAcidEnd":7096,"aminoAcidStart":6799,"nature":"Recombinant","expressionSystem":null,"accessionNumber":"P0DTD1","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The SARS-CoV-2 nonstructural proteins Nsp10 and Nsp16 known as cofactors for the viral RNA cap methylation process play a mechanical role in viral RNA synthesis. Nsp10 has a molecular weight of around 10 kDa while Nsp16 is approximately 33 kDa. These proteins are expressed primarily within host cells during viral infection. Nsp10 acts together with Nsp16 to form an active methyltransferase complex which modifies the cap structure of viral mRNA aiding in the evasion of the host's immune response.
Biological function summary

Nsp10 and Nsp16 contribute to the effective replication and transcription of the viral genome by modifying the 5' cap of viral mRNA. Nsp16 with the help of Nsp10 performs a 2'-O-methylation of the nucleotide adjacent to the cap which is an essential step for mRNA processing. This cap methylation is part of a larger complex involving multiple other nonstructural proteins facilitating viral replication. The Nsp10/Nsp16 complex ensures that viral mRNA can mimic host mRNA therefore avoiding detection by the host immune system.

Pathways

Nsp10 and Nsp16 integrate into the viral life cycle pathways specifically in RNA processing and modification. The Nsp10/Nsp16 complex works closely with the RNA-dependent RNA polymerase (RdRp) and other nonstructural proteins involved in RNA synthesis. These interactions contribute to the formation of the replication-transcription complex (RTC) which is critical for the virus's efficiency in replicating and transcribing its RNA genome.

Nsp10 and Nsp16 are linked to COVID-19 caused by SARS-CoV-2 and related respiratory diseases. The critical role of these proteins in evading host immune responses makes them potential targets for antiviral drug development. Their interaction with the RdRp and other cofactors like Nsp7 and Nsp8 highlights their contribution to the pathogenicity of the virus causing severe outcomes in some individuals affected by COVID-19. Understanding the function and mechanism of these proteins provides insight into therapeutic strategies for infection control.

Specifications

Form

Liquid

Additional notes

nan

General info

Function

Replicase polyprotein 1ab. Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.. Host translation inhibitor nsp1. Inhibits host translation by associating with the open head conformation of the 40S subunit (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). The C-terminus binds to and obstructs ribosomal mRNA entry tunnel (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). Thereby inhibits antiviral response triggered by innate immunity or interferons (PubMed : 32680882, PubMed : 32979938, PubMed : 33080218). The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation (By similarity). This inhibits the integrated stress response (ISR) in the infected cell by preventing EIF2S1/eIF2-alpha phosphorylation upstream of stress granule formation and depletes host G3BP1 (PubMed : 36534661). Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence (PubMed : 32908316, PubMed : 33080218).. Non-structural protein 2. Enhances mRNA repression of the 4EHP-GYF2 complex in the host, thereby inhibiting the antiviral response and facilitating SARS-CoV-2 replication. Possibly acts in cooperation with nsp1, which induces ribosome stalling on host mRNA, triggering mRNA repression by the host 4EHP-GYF2 complex which is enhanced by nsp2.. Papain-like protease nsp3. Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication (PubMed : 35551511). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed : 32733001). Prevents also host NF-kappa-B signaling (By similarity). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed : 32726803). Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not RIGI (PubMed : 33727702). Can play a role in host ADP-ribosylation by ADP-ribose (PubMed : 32578982). Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. Non-structural protein 4. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. 3C-like proteinase nsp5. Cleaves the C-terminus of replicase polyprotein at 11 sites (PubMed : 32321856). Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN] (PubMed : 32198291, PubMed : 32272481). May cleave human NLRP1 in lung epithelial cells, thereby activating the NLRP1 inflammasome pathway (PubMed : 35594856). May cleave human GSDMD, triggering alternative GSDME-mediated epithelial cell death upon activation of the NLRP1 inflammasome, which may enhance the release interleukins 1B, 6, 16 and 18 (PubMed : 35594856). Also able to bind an ADP-ribose-1''-phosphate (ADRP) (PubMed : 32198291, PubMed : 32272481).. Non-structural protein 6. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511). LDs are consumed during DMV formation (PubMed : 35551511). Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Non-structural protein 7. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity).. Non-structural protein 8. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Viral protein genome-linked nsp9. Forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains (PubMed : 37794589). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP8, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Non-structural protein 10. Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease (By similarity) and nsp16 2'-O-methyltransferase activities (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation.. RNA-directed RNA polymerase nsp12. RNA-directed RNA polymerase that catalyzes the transcription of viral genomic and subgenomic RNAs. Acts in complex with nsp7 and nsp8 to transcribe both the minus and positive strands of genomic RNA (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). The kinase-like NiRAN domain of NSP12 attaches one or more nucleotides to the amino terminus of NSP9, forming a covalent RNA-protein intermediate that serves as transcription/replication primer (PubMed : 37794589). Subgenomic RNAs (sgRNAs) are formed by discontinuous transcription : The polymerase has the ability to pause at transcription-regulating sequences (TRS) and jump to the leader TRS, resulting in a major deletion (PubMed : 35706445). This creates a series of subgenomic RNAs that are replicated, transcribed and translated (PubMed : 35706445). In addition, Nsp12 is a subunit of the viral RNA capping enzyme that catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs (PubMed : 35944563). Subsequently, the NiRAN domain transfers RNA to GDP, and forms the core cap structure GpppA-RNA (PubMed : 35944563).. Helicase nsp13. Plays a role in viral RNA synthesis (PubMed : 33232691). Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium (By similarity). Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Guanine-N7 methyltransferase nsp14. Plays a role in viral RNA synthesis through two distinct activities. The N7-guanine methyltransferase activity plays a role in the formation of the cap structure GpppA-RNA (PubMed : 35944563). The proofreading exoribonuclease reduces the sensitivity of the virus to RNA mutagens during replication (By similarity). This activity acts on both ssRNA and dsRNA in a 3'-5' direction (By similarity).. Uridylate-specific endoribonuclease nsp15. Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (By similarity). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs (PubMed : 33504779, PubMed : 33564093). Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed : 33504779, PubMed : 33564093). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (By similarity). May bind genomic dsRNA in association with the replication-transcription complex (RTC), and play a role in nsp12 discontinous transcription (PubMed : 34562452, PubMed : 35706445).. 2'-O-methyltransferase nsp16. Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed : 35944563). N7-methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed : 35944563). May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs (PubMed : 33080218).

Sequence similarities

Belongs to the coronaviruses polyprotein 1ab family.

Post-translational modifications

Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed.

Subcellular localisation

Host endosome

Product protocols

Target data

Replicase polyprotein 1ab. Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.. Host translation inhibitor nsp1. Inhibits host translation by associating with the open head conformation of the 40S subunit (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). The C-terminus binds to and obstructs ribosomal mRNA entry tunnel (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). Thereby inhibits antiviral response triggered by innate immunity or interferons (PubMed : 32680882, PubMed : 32979938, PubMed : 33080218). The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation (By similarity). This inhibits the integrated stress response (ISR) in the infected cell by preventing EIF2S1/eIF2-alpha phosphorylation upstream of stress granule formation and depletes host G3BP1 (PubMed : 36534661). Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence (PubMed : 32908316, PubMed : 33080218).. Non-structural protein 2. Enhances mRNA repression of the 4EHP-GYF2 complex in the host, thereby inhibiting the antiviral response and facilitating SARS-CoV-2 replication. Possibly acts in cooperation with nsp1, which induces ribosome stalling on host mRNA, triggering mRNA repression by the host 4EHP-GYF2 complex which is enhanced by nsp2.. Papain-like protease nsp3. Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication (PubMed : 35551511). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed : 32733001). Prevents also host NF-kappa-B signaling (By similarity). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed : 32726803). Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not RIGI (PubMed : 33727702). Can play a role in host ADP-ribosylation by ADP-ribose (PubMed : 32578982). Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. Non-structural protein 4. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. 3C-like proteinase nsp5. Cleaves the C-terminus of replicase polyprotein at 11 sites (PubMed : 32321856). Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN] (PubMed : 32198291, PubMed : 32272481). May cleave human NLRP1 in lung epithelial cells, thereby activating the NLRP1 inflammasome pathway (PubMed : 35594856). May cleave human GSDMD, triggering alternative GSDME-mediated epithelial cell death upon activation of the NLRP1 inflammasome, which may enhance the release interleukins 1B, 6, 16 and 18 (PubMed : 35594856). Also able to bind an ADP-ribose-1''-phosphate (ADRP) (PubMed : 32198291, PubMed : 32272481).. Non-structural protein 6. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511). LDs are consumed during DMV formation (PubMed : 35551511). Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Non-structural protein 7. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity).. Non-structural protein 8. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Viral protein genome-linked nsp9. Forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains (PubMed : 37794589). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP8, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Non-structural protein 10. Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease (By similarity) and nsp16 2'-O-methyltransferase activities (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation.. RNA-directed RNA polymerase nsp12. RNA-directed RNA polymerase that catalyzes the transcription of viral genomic and subgenomic RNAs. Acts in complex with nsp7 and nsp8 to transcribe both the minus and positive strands of genomic RNA (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). The kinase-like NiRAN domain of NSP12 attaches one or more nucleotides to the amino terminus of NSP9, forming a covalent RNA-protein intermediate that serves as transcription/replication primer (PubMed : 37794589). Subgenomic RNAs (sgRNAs) are formed by discontinuous transcription : The polymerase has the ability to pause at transcription-regulating sequences (TRS) and jump to the leader TRS, resulting in a major deletion (PubMed : 35706445). This creates a series of subgenomic RNAs that are replicated, transcribed and translated (PubMed : 35706445). In addition, Nsp12 is a subunit of the viral RNA capping enzyme that catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs (PubMed : 35944563). Subsequently, the NiRAN domain transfers RNA to GDP, and forms the core cap structure GpppA-RNA (PubMed : 35944563).. Helicase nsp13. Plays a role in viral RNA synthesis (PubMed : 33232691). Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium (By similarity). Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Guanine-N7 methyltransferase nsp14. Plays a role in viral RNA synthesis through two distinct activities. The N7-guanine methyltransferase activity plays a role in the formation of the cap structure GpppA-RNA (PubMed : 35944563). The proofreading exoribonuclease reduces the sensitivity of the virus to RNA mutagens during replication (By similarity). This activity acts on both ssRNA and dsRNA in a 3'-5' direction (By similarity).. Uridylate-specific endoribonuclease nsp15. Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (By similarity). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs (PubMed : 33504779, PubMed : 33564093). Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed : 33504779, PubMed : 33564093). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (By similarity). May bind genomic dsRNA in association with the replication-transcription complex (RTC), and play a role in nsp12 discontinous transcription (PubMed : 34562452, PubMed : 35706445).. 2'-O-methyltransferase nsp16. Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed : 35944563). N7-methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed : 35944563). May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs (PubMed : 33080218).
See full target information rep

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com