JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB289787

Recombinant Human coronavirus SARS-CoV-2 nsp9 protein

Be the first to review this product! Submit a review

|

(0 Publication)

Recombinant Human coronavirus SARS-CoV-2 nsp9 protein is a SARS-CoV-2 Full Length protein, in the 1 to 113 aa range, expressed in Escherichia coli, with >90%, suitable for SDS-PAGE.

View Alternative Names

1a-1b, rep, Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein

1 Images
SDS-PAGE - Recombinant Human coronavirus SARS-CoV-2 nsp9 protein (AB289787)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human coronavirus SARS-CoV-2 nsp9 protein (AB289787)

SDS-PAGE analysis of ab289787

Key facts

Purity

>90% SDS-PAGE

Expression system

Escherichia coli

Tags

His tag C-Terminus

Applications

SDS-PAGE

applications

Biologically active

No

Accession

P0DTD1

Animal free

Yes

Carrier free

No

Species

SARS-CoV-2

Storage buffer

pH: 7.4 - 8 Constituents: 6% Trehalose, 2.9% Sodium chloride, 0.24% Tris

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Sequence info

[{"sequence":"NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ","proteinLength":"Full Length","predictedMolecularWeight":"13.9 kDa","actualMolecularWeight":null,"aminoAcidEnd":113,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"Escherichia coli","accessionNumber":"P0DTD1","tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Blue Ice
Appropriate short-term storage duration
1-2 weeks
Appropriate short-term storage conditions
+4°C
Appropriate long-term storage conditions
-20°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

SARS-CoV-2 nsp9 also known as non-structural protein 9 plays an important role in viral replication. With a molecular weight of approximately 12 kDa this protein is integral to the replication and transcription complex of SARS-CoV-2 and is expressed during viral infection within host cells. Nsp9 facilitates the synthesis of RNA by binding to single-stranded RNA. This unique RNA-binding feature distinguishes it from other viral proteins implying its specific function in sustaining the viral genome.
Biological function summary

Nsp9 contributes significantly to the process of viral RNA replication. It functions within a complex that includes other non-structural proteins forming a multi-protein assembly necessary for efficient genome replication. This process ensures the viral RNA is correctly copied and translated therefore maintaining the infectivity of SARS-CoV-2. Nsp9's contribution to RNA binding and stabilization plays an important role in controlling the replication accuracy and speed of the virus.

Pathways

Nsp9 participates in the viral replication and transcription pathways of SARS-CoV-2. It interacts closely with proteins like nsp7 and nsp8 which are also a part of the replication machinery. These interactions within the RNA synthesis pathway facilitate the continuous production of viral components sustaining the life cycle of the virus within the host. Understanding these pathways provides insights into potential therapeutic targets to disrupt viral replication.

Nsp9 features prominently in COVID-19 the disease caused by SARS-CoV-2 infection. The protein's role in replication links it to the spread and severity of the infection. Targeting nsp9 could serve as a potential strategy for antiviral therapies. Moreover its interactions with other non-structural proteins such as nsp12 RNA-dependent RNA polymerase highlight the interconnectedness of these proteins in the progression of SARS-CoV-2-related pathology.

Specifications

Form

Lyophilized

General info

Function

Replicase polyprotein 1ab. Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.. Host translation inhibitor nsp1. Inhibits host translation by associating with the open head conformation of the 40S subunit (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). The C-terminus binds to and obstructs ribosomal mRNA entry tunnel (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). Thereby inhibits antiviral response triggered by innate immunity or interferons (PubMed : 32680882, PubMed : 32979938, PubMed : 33080218). The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation (By similarity). This inhibits the integrated stress response (ISR) in the infected cell by preventing EIF2S1/eIF2-alpha phosphorylation upstream of stress granule formation and depletes host G3BP1 (PubMed : 36534661). Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence (PubMed : 32908316, PubMed : 33080218).. Non-structural protein 2. Enhances mRNA repression of the 4EHP-GYF2 complex in the host, thereby inhibiting the antiviral response and facilitating SARS-CoV-2 replication. Possibly acts in cooperation with nsp1, which induces ribosome stalling on host mRNA, triggering mRNA repression by the host 4EHP-GYF2 complex which is enhanced by nsp2.. Papain-like protease nsp3. Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication (PubMed : 35551511). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed : 32733001). Prevents also host NF-kappa-B signaling (By similarity). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed : 32726803). Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not RIGI (PubMed : 33727702). Can play a role in host ADP-ribosylation by ADP-ribose (PubMed : 32578982). Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. Non-structural protein 4. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. 3C-like proteinase nsp5. Cleaves the C-terminus of replicase polyprotein at 11 sites (PubMed : 32321856). Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN] (PubMed : 32198291, PubMed : 32272481). May cleave human NLRP1 in lung epithelial cells, thereby activating the NLRP1 inflammasome pathway (PubMed : 35594856). May cleave human GSDMD, triggering alternative GSDME-mediated epithelial cell death upon activation of the NLRP1 inflammasome, which may enhance the release interleukins 1B, 6, 16 and 18 (PubMed : 35594856). Also able to bind an ADP-ribose-1''-phosphate (ADRP) (PubMed : 32198291, PubMed : 32272481).. Non-structural protein 6. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511). LDs are consumed during DMV formation (PubMed : 35551511). Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Non-structural protein 7. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity).. Non-structural protein 8. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Viral protein genome-linked nsp9. Forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains (PubMed : 37794589). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP8, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Non-structural protein 10. Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease (By similarity) and nsp16 2'-O-methyltransferase activities (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation.. RNA-directed RNA polymerase nsp12. RNA-directed RNA polymerase that catalyzes the transcription of viral genomic and subgenomic RNAs. Acts in complex with nsp7 and nsp8 to transcribe both the minus and positive strands of genomic RNA (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). The kinase-like NiRAN domain of NSP12 attaches one or more nucleotides to the amino terminus of NSP9, forming a covalent RNA-protein intermediate that serves as transcription/replication primer (PubMed : 37794589). Subgenomic RNAs (sgRNAs) are formed by discontinuous transcription : The polymerase has the ability to pause at transcription-regulating sequences (TRS) and jump to the leader TRS, resulting in a major deletion (PubMed : 35706445). This creates a series of subgenomic RNAs that are replicated, transcribed and translated (PubMed : 35706445). In addition, Nsp12 is a subunit of the viral RNA capping enzyme that catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs (PubMed : 35944563). Subsequently, the NiRAN domain transfers RNA to GDP, and forms the core cap structure GpppA-RNA (PubMed : 35944563).. Helicase nsp13. Plays a role in viral RNA synthesis (PubMed : 33232691). Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium (By similarity). Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Guanine-N7 methyltransferase nsp14. Plays a role in viral RNA synthesis through two distinct activities. The N7-guanine methyltransferase activity plays a role in the formation of the cap structure GpppA-RNA (PubMed : 35944563). The proofreading exoribonuclease reduces the sensitivity of the virus to RNA mutagens during replication (By similarity). This activity acts on both ssRNA and dsRNA in a 3'-5' direction (By similarity).. Uridylate-specific endoribonuclease nsp15. Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (By similarity). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs (PubMed : 33504779, PubMed : 33564093). Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed : 33504779, PubMed : 33564093). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (By similarity). May bind genomic dsRNA in association with the replication-transcription complex (RTC), and play a role in nsp12 discontinous transcription (PubMed : 34562452, PubMed : 35706445).. 2'-O-methyltransferase nsp16. Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed : 35944563). N7-methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed : 35944563). May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs (PubMed : 33080218).

Sequence similarities

Belongs to the coronaviruses polyprotein 1ab family.

Post-translational modifications

Specific enzymatic cleavages in vivo by its own proteases yield mature proteins. 3CL-PRO and PL-PRO proteinases are autocatalytically processed.

Subcellular localisation

Host endosome

Product protocols

Target data

Replicase polyprotein 1ab. Multifunctional protein involved in the transcription and replication of viral RNAs. Contains the proteinases responsible for the cleavages of the polyprotein.. Host translation inhibitor nsp1. Inhibits host translation by associating with the open head conformation of the 40S subunit (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). The C-terminus binds to and obstructs ribosomal mRNA entry tunnel (PubMed : 32680882, PubMed : 32908316, PubMed : 33080218, PubMed : 33479166). Thereby inhibits antiviral response triggered by innate immunity or interferons (PubMed : 32680882, PubMed : 32979938, PubMed : 33080218). The nsp1-40S ribosome complex further induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, targeting them for degradation (By similarity). This inhibits the integrated stress response (ISR) in the infected cell by preventing EIF2S1/eIF2-alpha phosphorylation upstream of stress granule formation and depletes host G3BP1 (PubMed : 36534661). Viral mRNAs less susceptible to nsp1-mediated inhibition of translation, because of their 5'-end leader sequence (PubMed : 32908316, PubMed : 33080218).. Non-structural protein 2. Enhances mRNA repression of the 4EHP-GYF2 complex in the host, thereby inhibiting the antiviral response and facilitating SARS-CoV-2 replication. Possibly acts in cooperation with nsp1, which induces ribosome stalling on host mRNA, triggering mRNA repression by the host 4EHP-GYF2 complex which is enhanced by nsp2.. Papain-like protease nsp3. Responsible for the cleavages located at the N-terminus of the replicase polyprotein. Participates together with nsp4 in the assembly of virally-induced cytoplasmic double-membrane vesicles necessary for viral replication (PubMed : 35551511). Antagonizes innate immune induction of type I interferon by blocking the phosphorylation, dimerization and subsequent nuclear translocation of host IRF3 (PubMed : 32733001). Prevents also host NF-kappa-B signaling (By similarity). In addition, PL-PRO possesses a deubiquitinating/deISGylating activity and processes both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains from cellular substrates (PubMed : 32726803). Cleaves preferentially ISG15 from antiviral protein IFIH1 (MDA5), but not RIGI (PubMed : 33727702). Can play a role in host ADP-ribosylation by ADP-ribose (PubMed : 32578982). Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. Non-structural protein 4. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511).. 3C-like proteinase nsp5. Cleaves the C-terminus of replicase polyprotein at 11 sites (PubMed : 32321856). Recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN] (PubMed : 32198291, PubMed : 32272481). May cleave human NLRP1 in lung epithelial cells, thereby activating the NLRP1 inflammasome pathway (PubMed : 35594856). May cleave human GSDMD, triggering alternative GSDME-mediated epithelial cell death upon activation of the NLRP1 inflammasome, which may enhance the release interleukins 1B, 6, 16 and 18 (PubMed : 35594856). Also able to bind an ADP-ribose-1''-phosphate (ADRP) (PubMed : 32198291, PubMed : 32272481).. Non-structural protein 6. Plays a role in the formation and maintenance of double membrane vesicles (DMVs) replication organelles (PubMed : 35551511). DMVs are formed by nsp3 and nsp4, while nsp6 zippers ER membranes and connects to lipid droplets (PubMed : 35551511). LDs are consumed during DMV formation (PubMed : 35551511). Binds to host TBK1 without affecting TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Non-structural protein 7. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp8 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity).. Non-structural protein 8. Plays a role in viral RNA synthesis (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). Forms a hexadecamer with nsp7 (8 subunits of each) that may participate in viral replication by acting as a primase. Alternatively, may synthesize substantially longer products than oligonucleotide primers (By similarity). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP9, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Viral protein genome-linked nsp9. Forms a primer, NSP9-pU, which is utilized by the polymerase for the initiation of RNA chains (PubMed : 37794589). Interacts with ribosome signal recognition particle RNA (SRP) (PubMed : 33080218). Together with NSP8, suppress protein integration into the cell membrane, thereby disrupting host immune defenses (PubMed : 33080218).. Non-structural protein 10. Plays a pivotal role in viral transcription by stimulating both nsp14 3'-5' exoribonuclease (By similarity) and nsp16 2'-O-methyltransferase activities (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation.. RNA-directed RNA polymerase nsp12. RNA-directed RNA polymerase that catalyzes the transcription of viral genomic and subgenomic RNAs. Acts in complex with nsp7 and nsp8 to transcribe both the minus and positive strands of genomic RNA (PubMed : 32277040, PubMed : 32358203, PubMed : 32438371, PubMed : 32526208). The kinase-like NiRAN domain of NSP12 attaches one or more nucleotides to the amino terminus of NSP9, forming a covalent RNA-protein intermediate that serves as transcription/replication primer (PubMed : 37794589). Subgenomic RNAs (sgRNAs) are formed by discontinuous transcription : The polymerase has the ability to pause at transcription-regulating sequences (TRS) and jump to the leader TRS, resulting in a major deletion (PubMed : 35706445). This creates a series of subgenomic RNAs that are replicated, transcribed and translated (PubMed : 35706445). In addition, Nsp12 is a subunit of the viral RNA capping enzyme that catalyzes the RNA guanylyltransferase reaction for genomic and sub-genomic RNAs (PubMed : 35944563). Subsequently, the NiRAN domain transfers RNA to GDP, and forms the core cap structure GpppA-RNA (PubMed : 35944563).. Helicase nsp13. Plays a role in viral RNA synthesis (PubMed : 33232691). Multi-functional protein with a zinc-binding domain in N-terminus displaying RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Activity of helicase is dependent on magnesium (By similarity). Binds to host TBK1 and inhibits TBK1 phosphorylation; the interaction with TBK1 decreases IRF3 phosphorylation, which leads to reduced IFN-beta production (PubMed : 32979938).. Guanine-N7 methyltransferase nsp14. Plays a role in viral RNA synthesis through two distinct activities. The N7-guanine methyltransferase activity plays a role in the formation of the cap structure GpppA-RNA (PubMed : 35944563). The proofreading exoribonuclease reduces the sensitivity of the virus to RNA mutagens during replication (By similarity). This activity acts on both ssRNA and dsRNA in a 3'-5' direction (By similarity).. Uridylate-specific endoribonuclease nsp15. Plays a role in viral transcription/replication and prevents the simultaneous activation of host cell dsRNA sensors, such as MDA5/IFIH1, OAS, and PKR (By similarity). Acts by degrading the 5'-polyuridines generated during replication of the poly(A) region of viral genomic and subgenomic RNAs (PubMed : 33504779, PubMed : 33564093). Catalyzes a two-step reaction in which a 2'3'-cyclic phosphate (2'3'-cP) is first generated by 2'-O transesterification, which is then hydrolyzed to a 3'-phosphate (3'-P) (PubMed : 33504779, PubMed : 33564093). If not degraded, poly(U) RNA would hybridize with poly(A) RNA tails and activate host dsRNA sensors (By similarity). May bind genomic dsRNA in association with the replication-transcription complex (RTC), and play a role in nsp12 discontinous transcription (PubMed : 34562452, PubMed : 35706445).. 2'-O-methyltransferase nsp16. Methyltransferase that mediates mRNA cap 2'-O-ribose methylation to the 5'-cap structure of viral mRNAs (PubMed : 35944563). N7-methyl guanosine cap is a prerequisite for binding of nsp16 (PubMed : 35944563). Therefore plays an essential role in viral mRNAs cap methylation which is essential to evade immune system (PubMed : 35944563). May disrupt host mRNA splicing in nucleus by interacting with pre-mRNA Recognition Domains ofthe U1 and U2 snRNAs (PubMed : 33080218).
See full target information rep

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com