JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB273065

Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active)

Be the first to review this product! Submit a review

|

(9 Publications)

Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) is a SARS-CoV-2 Fragment protein, in the 319 to 541 aa range, expressed in CHO cells, with >90%, suitable for SDS-PAGE, ELISA, Flow Cyt, FuncS.

View Alternative Names

2, S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein

3 Images
Flow Cytometry - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)
  • Flow Cyt

Supplier Data

Flow Cytometry - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)

Flow cytometry assay showing ab273065 can bind to ACE2 overexpressing cells. ACE2 overexpressing cells were labelledwith ab273065, followed by an anti-spike protein antibody, and a fluorescence-conjugated secondary antibody.

Functional Studies - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)
  • FuncS

Supplier Data

Functional Studies - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)

Binding ability measured in a funstional ELISA. Immobilized Human ACE2 protein at 2 ug/ml (100 ul/well) can bind to ab273065.

SDS-PAGE - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein RBD (Active) (AB273065)

SDS-PAGE analysis of ab273065.

Key facts

Purity

>90% SDS-PAGE

Expression system

CHO cells

Tags

His tag C-Terminus

Applications

SDS-PAGE, Flow Cyt, ELISA, FuncS

applications

Biologically active

Yes

Biological activity

Binding ability measured in a functional ELISA. Immobilized Human ACE2 protein at 2 ug/ml (100 ul/well) can bind to ab273065.

Accession

P0DTC2

Animal free

No

Carrier free

No

Species

SARS-CoV-2

Storage buffer

pH: 7.5 Preservative: 1.02% Imidazole Constituents: 1.74% Sodium chloride, 0.82% Sodium phosphate

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "Flow Cyt": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "FuncS": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"" } } }

Sequence info

[{"sequence":"RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGSGGGSGGHHHHHH","proteinLength":"Fragment","predictedMolecularWeight":null,"actualMolecularWeight":"39 kDa","aminoAcidEnd":541,"aminoAcidStart":319,"nature":"Recombinant","expressionSystem":"CHO cells","accessionNumber":null,"tags":[{"tag":"His","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-20°C
Appropriate long-term storage conditions
-20°C
Storage information
Avoid freeze / thaw cycle
True

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The SARS-CoV-2 Spike Glycoprotein Receptor Binding Domain (RBD) commonly referred to as 'anti-RBD' or 'COVID-19 RBD' plays a critical role in the viral entry mechanism of the SARS-CoV-2 virus. The RBD is part of the larger Spike (S) glycoprotein which has a molecular mass of about 180 kDa. This RBD is located on the surface of the virus and is responsible for binding to the angiotensin-converting enzyme 2 (ACE2) receptor on host cells. Expression of the RBD occurs in the Spike protein which is synthesized during the viral replication cycle in infected host cells.
Biological function summary

The SARS-CoV-2 Spike Glycoprotein RBD initiates attachment to host cells by specifically binding to the ACE2 receptor facilitating viral entry. The RBD is part of a larger trimeric complex where each monomer consists of an S1 and S2 domain. The S1 domain which includes the RBD is important for receptor binding while the S2 domain aids in membrane fusion. By mediating these initial interactions with host cells the RBD dictates the entry and infectivity of the virus.

Pathways

The interaction of the SARS-CoV-2 RBD with ACE2 is an important event in the entry pathways of the virus. This interaction triggers a cascade of events leading to endocytosis and viral replication. The virus utilizes the cellular machinery by hijacking the ACE2-mediated entry pathway which involves proteolytic processing by transmembrane protease serine 2 (TMPRSS2). The RBD's role connects closely with these proteins playing a vital part in both viral fusion and endocytosis pathways.

The RBD of the SARS-CoV-2 Spike Glycoprotein is directly connected to COVID-19 the disease caused by the SARS-CoV-2 virus. This domain is a target for neutralizing antibodies such as 'anti-RBD' which can block the interaction with ACE2 potentially preventing infection. Additionally the RBD is implicated in COVID-19-related syndromes and conditions including severe acute respiratory distress syndrome. The Spike glycoprotein's significant interaction with ACE2 plays a role in the pathogenesis of these conditions by facilitating viral entry and propagation.

Specifications

Form

Liquid

Additional notes

Purity is lot specific. Please contact our technical Support team for details.

General info

Function

Spike protein S1. Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. The major receptor is host ACE2 (PubMed : 32142651, PubMed : 32155444, PubMed : 33607086). When S2/S2' has been cleaved, binding to the receptor triggers direct fusion at the cell membrane (PubMed : 34561887). When S2/S2' has not been cleaved, binding to the receptor results in internalization of the virus by endocytosis leading to fusion of the virion membrane with the host endosomal membrane (PubMed : 32075877, PubMed : 32221306). Alternatively, may use NRP1/NRP2 (PubMed : 33082294, PubMed : 33082293) and integrin as entry receptors (PubMed : 35150743). The use of NRP1/NRP2 receptors may explain the tropism of the virus in human olfactory epithelial cells, which express these molecules at high levels but ACE2 at low levels (PubMed : 33082293). The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed : 32817270).. Spike protein S2. Precursor of the fusion protein processed in the biosynthesis of the S protein and the formation of virus particle. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains two viral fusion peptides that are unmasked after cleavage. The S2/S2' cleavage occurs during virus entry at the cell membrane by host TMPRSS2 (PubMed : 32142651) or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change leading to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.. Spike protein S2'. Subunit of the fusion protein that is processed upon entry into the host cell. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains a viral fusion peptide that is unmasked after S2 cleavage. This cleavage can occur at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change that leads to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.

Sequence similarities

Belongs to the betacoronaviruses spike protein family.

Post-translational modifications

The cytoplasmic Cys-rich domain is palmitoylated. Palmitoylated spike proteins drive the formation of localized ordered cholesterol and sphingo-lipid-rich lipid nanodomains in the early Golgi, where viral budding occurs.. Specific enzymatic cleavages in vivo yield mature proteins. The precursor is processed into S1 and S2 by host furin or unknown proteases to yield the mature S1 and S2 proteins (PubMed:32155444, PubMed:32362314, PubMed:32703818, PubMed:34159616, PubMed:34561887). Processing between S2 and S2' occurs either by host CTSL in endosomes (PubMed:32221306, PubMed:33465165, PubMed:34159616), or by host TMPRSS2 at the cell surface (PubMed:32142651). Both cleavages are necessary for the protein to be fusion competent (PubMed:32703818, PubMed:34159616, PubMed:34561887). Cell surface activation allows the virus to enter the cell despite inhibition of the endosomal pathway by hydroxychloroquine (PubMed:33465165). The polybasic furin cleavage site is absent in SARS-CoV S (PubMed:32155444, PubMed:32362314, PubMed:33465165). It increases the dependence on TMPRSS2 expression by SARS-CoV-2 (PubMed:33465165). D614G substitution would enhance furin cleavage at the S1/S2 junction (PubMed:33417835).. Highly decorated by heterogeneous N-linked glycans protruding from the trimer surface (PubMed:32075877, PubMed:32155444, PubMed:32929138). Highly glycosylated by host both on S1 and S2 subunits, occluding many regions across the surface of the protein (PubMed:32363391, PubMed:32366695, PubMed:32929138). Approximately 40% of the protein surface is shielded from antibody recognition by glycans, with the notable exception of the ACE2 receptor binding domain (PubMed:32929138).. O-glycosylated by host GALNT1 at the end of S1. This could reduce the efficiency of S1/S2 cleavage.

Product protocols

Target data

Spike protein S1. Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. The major receptor is host ACE2 (PubMed : 32142651, PubMed : 32155444, PubMed : 33607086). When S2/S2' has been cleaved, binding to the receptor triggers direct fusion at the cell membrane (PubMed : 34561887). When S2/S2' has not been cleaved, binding to the receptor results in internalization of the virus by endocytosis leading to fusion of the virion membrane with the host endosomal membrane (PubMed : 32075877, PubMed : 32221306). Alternatively, may use NRP1/NRP2 (PubMed : 33082294, PubMed : 33082293) and integrin as entry receptors (PubMed : 35150743). The use of NRP1/NRP2 receptors may explain the tropism of the virus in human olfactory epithelial cells, which express these molecules at high levels but ACE2 at low levels (PubMed : 33082293). The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed : 32817270).. Spike protein S2. Precursor of the fusion protein processed in the biosynthesis of the S protein and the formation of virus particle. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains two viral fusion peptides that are unmasked after cleavage. The S2/S2' cleavage occurs during virus entry at the cell membrane by host TMPRSS2 (PubMed : 32142651) or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change leading to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.. Spike protein S2'. Subunit of the fusion protein that is processed upon entry into the host cell. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains a viral fusion peptide that is unmasked after S2 cleavage. This cleavage can occur at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change that leads to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.
See full target information S

Publications (9)

Recent publications for all applications. Explore the full list and refine your search

International journal of molecular sciences 24: PubMed37298438

2023

Recombinant SARS-CoV-2 Spike Protein Stimulates Secretion of Chymase, Tryptase, and IL-1β from Human Mast Cells, Augmented by IL-33.

Applications

Unspecified application

Species

Unspecified reactive species

Irene Tsilioni,Theoharis C Theoharides

Sensors (Basel, Switzerland) 23: PubMed37112287

2023

Portable Surface Plasmon Resonance Detector for COVID-19 Infection.

Applications

Unspecified application

Species

Unspecified reactive species

Maciej Trzaskowski,Anna Mazurkiewicz-Pisarek,Jakub Waldemar Trzciński,Marcin Drozd,Rafał Podgórski,Anna Zabost,Ewa Augustynowicz-Kopeć

ACS applied materials & interfaces 14:54527-54538 PubMed36454041

2022

Colorimetric Detection of SARS-CoV-2 Using Plasmonic Biosensors and Smartphones.

Applications

Unspecified application

Species

Unspecified reactive species

Elsa M Materón,Faustino R Gómez,Mariana B Almeida,Flavio M Shimizu,Ademar Wong,Kelcilene B R Teodoro,Filipe S R Silva,Manoel J A Lima,Monara Kaelle S C Angelim,Matias E Melendez,Nelson Porras,Pedro M Vieira,Daniel S Correa,Emanuel Carrilho,Osvaldo N Oliveira,Ricardo B Azevedo,Débora Goncalves

Journal of King Saud University. Science 34:102296 PubMed36062198

2022

ZnO-chlorogenic acid nanostructured complex inhibits Covid-19 pathogenesis and increases hydroxychloroquine efficacy.

Applications

Unspecified application

Species

Unspecified reactive species

Mosleh M Abomughaid,Mohammed S Nofal,Khaled I Ghaleb,Mohamed G Seadawy,Miral G AbdEl-Wahab,Alaa S Hegazy,Doaa A Ghareeb

Science advances 8:eabn2378 PubMed36001655

2022

Femtomolar detection of SARS-CoV-2 via peptide beacons integrated on a miniaturized TIRF microscope.

Applications

Unspecified application

Species

Unspecified reactive species

Soumya P Tripathy,Manvitha Ponnapati,Suhaas Bhat,Joseph Jacobson,Pranam Chatterjee

Function (Oxford, England) 3:zqac002 PubMed35284826

2022

SARS-CoV-2 S Protein Subunit 1 Elicits Ca Influx - Dependent Ca Signals in Pancreatic Stellate Cells and Macrophages .

Applications

Unspecified application

Species

Unspecified reactive species

Julia V Gerasimenko,Ole H Petersen,Oleg V Gerasimenko

BioMed research international 2021:6614000 PubMed34337036

2021

Characterization of the Modulatory Effect of Hydroxychloroquine on ACE2 Activity: New Insights in relation to COVID-19.

Applications

Unspecified application

Species

Unspecified reactive species

Juan E Tichauer,Dagoberto Soto,Max Andresen

ACS nano 15:11743-11752 PubMed34128653

2021

COVID-19 Spike Protein Induced Phononic Modification in Antibody-Coupled Graphene for Viral Detection Application.

Applications

Unspecified application

Species

Unspecified reactive species

Ngoc Hoang Lan Nguyen,Sungjoon Kim,Garrett Lindemann,Vikas Berry

ACS sensors 6:1270-1278 PubMed33629833

2021

Microfluidic Magneto Immunosensor for Rapid, High Sensitivity Measurements of SARS-CoV-2 Nucleocapsid Protein in Serum.

Applications

Unspecified application

Species

Unspecified reactive species

Jiran Li,Peter B Lillehoj
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com