JavaScript is disabled in your browser. Please enable JavaScript to view this website.
AB272105

Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera)

Be the first to review this product! Submit a review

|

(7 Publications)

Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) is a SARS-CoV-2 Fragment protein, in the 1 to 674 aa range, expressed in HEK 293 cells, with >95%, < 1 EU/mL endotoxin level, suitable for SDS-PAGE, I-ELISA.

View Alternative Names

2, S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein

10 Images
Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab273073 (CR3022, human chimeric) binding to the antigens ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) and ab273068 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Active)). Plates were coated with 100ng/well ab272105 or ab273068 and binding of ab273073 assessed in serial dilution from 200ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab277513 (CV30) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277513 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab277512 (CV1) binding to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)). Plates were coated with 100ng/well ab272105 and binding of ab277512 assessed in serial dilution from 100ng/ml primary antibody in duplicate. Binding was detected using ab98624, an anti-human Fc secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect competition ELISA showing competitive binding of primary antibody ab277512 (CV1) to antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect competition ELISA showing competitive binding of primary antibody ab277513 (CV30) to the antigen ab272105 (recombinant human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (sheep Fc fusion)) in the presence of 2nM His-tagged human ACE2. Plates were coated with 100ng/well ab272105 and binding of the recombinant ACE2 determined in duplicate in the presence of a serial dilution (from 330nM) of primary antibody. His-tagged ACE2 binding was detected using ab1187, an anti-His tag secondary conjugated to HRP. Data are represented as the mean and error bars represent standard deviation.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab323001 binding to Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105). Plates were coated with Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105), Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S2 (Fc Chimera, ab272106) and Recombinant Human coronavirus SARS spike glycoprotein (Tagged, ab270844) at 1000 ng/ml. Binding of ab323001 was assessed in a serial dilution range 0.016- 1000 ng/mL (a 3-fold serial dilution). Secondary antibody, Goat Anti-Chicken IgY H&L (HRP, ab6877) was used at 1 : 5000.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab322272 binding to Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105). Plates were coated with Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105) and Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S2 (Fc Chimera, ab272106) at 1000 ng/ml. Binding of ab322272 was assessed in a serial dilution range 0.016- 1000 ng/mL (a 3-fold serial dilution). Secondary antibody, Goat Anti-Human IgG Fc (HRP) preadsorbed (ab98624) was used at 1 : 5000.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab323000 binding to Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105). Plates were coated with Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105), Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S2 (Fc Chimera, ab272106) and Recombinant human coronavirus SARS spike glycoprotein (Tagged, ab270844) at 1000 ng/ml. Binding of ab323000 was assessed in a serial dilution range 0.016- 1000 ng/mL (a 3-fold serial dilution). Secondary antibody, Goat Anti-Human IgG Fc (HRP) preadsorbed (ab98624) was used at 1 : 5000.

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • I-ELISA

Lab

Indirect ELISA - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

Indirect ELISA showing primary antibody ab322999 binding to Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105). Plates were coated with Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera, ab272105), Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S2 (Fc Chimera, ab272106) and Recombinant Human coronavirus SARS spike glycoprotein (Tagged, ab270844) at 1000 ng/ml. Binding of ab322999 was assessed in a serial dilution range 0.016- 1000 ng/mL (a 3-fold serial dilution). Secondary antibody, Goat Anti-Chicken IgY H&L (HRP, ab6877) was used at 1 : 5000.

SDS-PAGE - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)
  • SDS-PAGE

Supplier Data

SDS-PAGE - Recombinant Human coronavirus SARS-CoV-2 Spike Glycoprotein S1 (Fc Chimera) (AB272105)

SDS-PAGE analysis of ab272105.

Key facts

Purity

>95%

Endotoxin level

< 1 EU/mL

Expression system

HEK 293 cells

Tags

Sheep Fc tag C-Terminus

Applications

SDS-PAGE, I-ELISA

applications

Biologically active

No

Accession

P0DTC2

Animal free

No

Carrier free

No

Species

SARS-CoV-2

Storage buffer

pH: 7 - 8 Constituents: PBS

storage-buffer

Reactivity data

{ "title": "Reactivity Data", "filters": { "stats": ["", "Reactivity", "Dilution Info", "Notes"] }, "values": { "SDS-PAGE": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" }, "I-ELISA": { "reactivity":"TESTED_AND_REACTS", "dilution-info":"", "notes":"<p></p>" } } }

Product details

Predicted molecular weight: 130-140kD, including the Fc tag, Purity >95% SDS-PAGE

Sequence info

[{"sequence":"MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASY","proteinLength":"Fragment","predictedMolecularWeight":"101 kDa","actualMolecularWeight":"140 kDa","aminoAcidEnd":674,"aminoAcidStart":1,"nature":"Recombinant","expressionSystem":"HEK 293 cells","accessionNumber":"P0DTC2","tags":[{"tag":"Sheep Fc","terminus":"C-Terminus"}]}]

Properties and storage information

Shipped at conditions
Dry Ice
Appropriate short-term storage conditions
-80°C
Appropriate long-term storage conditions
-80°C
Aliquoting information
Upon delivery aliquot
Storage information
Avoid freeze / thaw cycle
False

Supplementary information

This supplementary information is collated from multiple sources and compiled automatically.

The SARS-CoV-2 Spike Glycoprotein S1 also known as the G10 spike or glycoprotein spike plays an important role in allowing the virus to attach and enter host cells. This protein with a mass of approximately 180 kDa is located on the surface of the virus and forms the outer spikes observed in coronaviruses. Expression of the spike glycoprotein is in virus-infected cells where it facilitates the interaction with host cell receptors. The S1 subunit includes a receptor-binding domain that specifically binds to the human angiotensin-converting enzyme 2 (ACE2) receptors initiating the infection process.
Biological function summary

The spike glycoprotein S1 mediates the fusion of the viral and cellular membranes which is necessary for viral entry. It forms part of a larger trimeric complex comprising S1 and S2 subunits. This complex undergoes conformational changes that drive the membrane fusion process. The glycoprotein contains multiple glycosylation sites which help shield the virus from the host immune response. The proper function and presentation of this glycoprotein are critical for efficient viral spread and infection establishment.

Pathways

The spike glycoprotein S1 is integral to the viral infection pathway and host immune evasion. It interacts with the renin-angiotensin system by binding to the ACE2 receptor disrupting normal receptor activity. This interaction not only facilitates viral entry but also impacts the homeostatic functions typically mediated by ACE2 which include blood pressure regulation. Additionally the spike protein is involved in downstream activation of immune signaling pathways including those related to inflammation and cytokine production which may involve proteins such as IL-6.

Infection with the spike glycoprotein S1 is directly related to COVID-19. The binding to ACE2 receptors is linked to the pathology of the disease contributing to respiratory symptoms and in severe cases acute respiratory distress syndrome (ARDS). Through the IL-6 signaling pathway the spike protein is indirectly connected to cytokine release syndrome often observed in severe COVID-19 cases. This connection highlights the importance of targeting this glycoprotein for potential therapeutic interventions and diagnostics such as ELISA SARS-CoV-2 tests and the development of anti-spike antibodies available on platforms like antispark.com for research and clinical purposes.

Specifications

Form

Liquid

General info

Function

Spike protein S1. Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. The major receptor is host ACE2 (PubMed : 32142651, PubMed : 32155444, PubMed : 33607086). When S2/S2' has been cleaved, binding to the receptor triggers direct fusion at the cell membrane (PubMed : 34561887). When S2/S2' has not been cleaved, binding to the receptor results in internalization of the virus by endocytosis using host TFRC and GRM2 and leading to fusion of the virion membrane with the host endosomal membrane (PubMed : 32075877, PubMed : 32221306, PubMed : 34903715, PubMed : 36779763). Alternatively, may use NRP1/NRP2 (PubMed : 33082294, PubMed : 33082293) and integrin as entry receptors (PubMed : 35150743). The use of NRP1/NRP2 receptors may explain the tropism of the virus in human olfactory epithelial cells, which express these molecules at high levels but ACE2 at low levels (PubMed : 33082293). Uses also ASGR1 as an alternative receptor in an ACE2-independent manner (PubMed : 34837059). The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed : 32817270).. Spike protein S2. Precursor of the fusion protein processed in the biosynthesis of the S protein and the formation of virus particle. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains two viral fusion peptides that are unmasked after cleavage. The S2/S2' cleavage occurs during virus entry at the cell membrane by host TMPRSS2 (PubMed : 32142651) or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change leading to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.. Spike protein S2'. Subunit of the fusion protein that is processed upon entry into the host cell. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains a viral fusion peptide that is unmasked after S2 cleavage. This cleavage can occur at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change that leads to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.

Sequence similarities

Belongs to the betacoronaviruses spike protein family.

Post-translational modifications

The cytoplasmic Cys-rich domain is palmitoylated. Palmitoylated spike proteins drive the formation of localized ordered cholesterol and sphingo-lipid-rich lipid nanodomains in the early Golgi, where viral budding occurs.. Specific enzymatic cleavages in vivo yield mature proteins. The precursor is processed into S1 and S2 by host furin or unknown proteases to yield the mature S1 and S2 proteins (PubMed:32155444, PubMed:32362314, PubMed:32703818, PubMed:34159616, PubMed:34561887). Processing between S2 and S2' occurs either by host CTSL in endosomes (PubMed:32221306, PubMed:33465165, PubMed:34159616), or by host TMPRSS2 at the cell surface (PubMed:32142651). Both cleavages are necessary for the protein to be fusion competent (PubMed:32703818, PubMed:34159616, PubMed:34561887). Cell surface activation allows the virus to enter the cell despite inhibition of the endosomal pathway by hydroxychloroquine (PubMed:33465165). The polybasic furin cleavage site is absent in SARS-CoV S (PubMed:32155444, PubMed:32362314, PubMed:33465165). It increases the dependence on TMPRSS2 expression by SARS-CoV-2 (PubMed:33465165). D614G substitution would enhance furin cleavage at the S1/S2 junction (PubMed:33417835).. Highly decorated by heterogeneous N-linked glycans protruding from the trimer surface (PubMed:32075877, PubMed:32155444, PubMed:32929138). Highly glycosylated by host both on S1 and S2 subunits, occluding many regions across the surface of the protein (PubMed:32363391, PubMed:32366695, PubMed:32929138). Approximately 40% of the protein surface is shielded from antibody recognition by glycans, with the notable exception of the ACE2 receptor binding domain (PubMed:32929138).. O-glycosylated by host GALNT1 at the end of S1. This could reduce the efficiency of S1/S2 cleavage.

Product protocols

Target data

Spike protein S1. Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. The major receptor is host ACE2 (PubMed : 32142651, PubMed : 32155444, PubMed : 33607086). When S2/S2' has been cleaved, binding to the receptor triggers direct fusion at the cell membrane (PubMed : 34561887). When S2/S2' has not been cleaved, binding to the receptor results in internalization of the virus by endocytosis using host TFRC and GRM2 and leading to fusion of the virion membrane with the host endosomal membrane (PubMed : 32075877, PubMed : 32221306, PubMed : 34903715, PubMed : 36779763). Alternatively, may use NRP1/NRP2 (PubMed : 33082294, PubMed : 33082293) and integrin as entry receptors (PubMed : 35150743). The use of NRP1/NRP2 receptors may explain the tropism of the virus in human olfactory epithelial cells, which express these molecules at high levels but ACE2 at low levels (PubMed : 33082293). Uses also ASGR1 as an alternative receptor in an ACE2-independent manner (PubMed : 34837059). The stalk domain of S contains three hinges, giving the head unexpected orientational freedom (PubMed : 32817270).. Spike protein S2. Precursor of the fusion protein processed in the biosynthesis of the S protein and the formation of virus particle. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains two viral fusion peptides that are unmasked after cleavage. The S2/S2' cleavage occurs during virus entry at the cell membrane by host TMPRSS2 (PubMed : 32142651) or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change leading to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.. Spike protein S2'. Subunit of the fusion protein that is processed upon entry into the host cell. Mediates fusion of the virion and cellular membranes by functioning as a class I viral fusion protein. Contains a viral fusion peptide that is unmasked after S2 cleavage. This cleavage can occur at the cell membrane by host TMPRSS2 or during endocytosis by host CSTL (PubMed : 32703818, PubMed : 34159616). In either case, this triggers an extensive and irreversible conformational change that leads to fusion of the viral envelope with the cellular cytoplasmic membrane, releasing viral genomic RNA into the host cell cytoplasm (PubMed : 34561887). Under the current model, the protein has at least three conformational states : pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During fusion of the viral and target cell membranes, the coiled coil regions (heptad repeats) adopt a trimer-of-hairpins structure and position the fusion peptide in close proximity to the C-terminal region of the ectodomain. Formation of this structure appears to promote apposition and subsequent fusion of viral and target cell membranes.
See full target information S

Additional targets

SARS-CoV-2 Spike Glycoprotein S1

Publications (7)

Recent publications for all applications. Explore the full list and refine your search

Nanoscale 16:19881-19896 PubMed39382227

2024

Multivalent nanobody engineering for enhanced physisorption and functional display on gold nanoparticles.

Applications

Unspecified application

Species

Unspecified reactive species

John-Paul Ayrton,Chapman Ho,Haoran Zhang,Vijay Chudasama,Stefanie Frank,Michael R Thomas

Scientific reports 12:20119 PubMed36418852

2022

A portable analog front-end system for label-free sensing of proteins using nanowell array impedance sensors.

Applications

Unspecified application

Species

Unspecified reactive species

Muhammad Tayyab,Pengfei Xie,Muhammad Ahsan Sami,Hassan Raji,Zhongtian Lin,Zhuolun Meng,Seyed Reza Mahmoodi,Mehdi Javanmard

International journal of molecular sciences 23: PubMed36498845

2022

N-acetylcysteine Reduces Inflammasome Activation Induced by SARS-CoV-2 Proteins In Vitro.

Applications

Unspecified application

Species

Unspecified reactive species

Javier Milara,Fernando Martínez-Expósito,Paula Montero,Inés Roger,Maria Amparo Bayarri,Pilar Ribera,Miriam Natsuki Oishi-Konari,Jose Ramón Alba-García,Enrique Zapater,Julio Cortijo

Vaccine: X 12:100202 PubMed35936992

2022

Secreted heat shock protein gp96-Ig and OX40L-Fc combination vaccine enhances SARS-CoV-2 Spike (S) protein-specific B and T cell immune responses.

Applications

Unspecified application

Species

Unspecified reactive species

Laura Padula,Eva Fisher,Katelyn Rivas,Kristin Podack,Daniela Frasca,Jonah Kupritz,Matthew M Seavey,Padmini Jayaraman,Eric Dixon,Rahul Jasuja,Natasa Strbo

Biosensors & bioelectronics: X 11:100167 PubMed35647519

2022

Evaluation of a photoelectrochemical platform based on strontium titanate, sulfur doped carbon nitride and palladium nanoparticles for detection of SARS-CoV-2 spike glycoprotein S1.

Applications

Unspecified application

Species

Unspecified reactive species

Chirlene N Botelho,Suringo S Falcão,Rossy-Eric P Soares,Silma R Pereira,Alan S de Menezes,Lauro T Kubota,Flavio S Damos,Rita C S Luz

Immunity 54:1463-1477.e11 PubMed34115964

2021

Metformin inhibition of mitochondrial ATP and DNA synthesis abrogates NLRP3 inflammasome activation and pulmonary inflammation.

Applications

Unspecified application

Species

Unspecified reactive species

Hongxu Xian,Yuan Liu,Alexandra Rundberg Nilsson,Raphaella Gatchalian,Timothy R Crother,Warren G Tourtellotte,Yi Zhang,German R Aleman-Muench,Gavin Lewis,Weixuan Chen,Sarah Kang,Melissa Luevanos,Dorit Trudler,Stuart A Lipton,Pejman Soroosh,John Teijaro,Juan Carlos de la Torre,Moshe Arditi,Michael Karin,Elsa Sanchez-Lopez

Theranostics 10:9458-9476 PubMed32863939

2020

Loss of SIRT4 promotes the self-renewal of Breast Cancer Stem Cells.

Applications

Unspecified application

Species

Unspecified reactive species

Lutao Du,Xiaoyan Liu,Yidan Ren,Juan Li,Peilong Li,Qinlian Jiao,Peng Meng,Fang Wang,Yuli Wang,Yun-Shan Wang,Chuanxin Wang
View all publications

Product promise

We are committed to supporting your work with high-quality reagents, and we're here for you every step of the way. In the unlikely event that one of our products does not perform as expected, you're protected by our Product Promise.
For full details, please see our Terms & Conditions

Please note: All products are 'FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC OR THERAPEUTIC PROCEDURES'.

For licensing inquiries, please contact partnerships@abcam.com